Basic Vector Information
- Vector Name:
- pBEXK
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6495 bp
- Type:
- Integrational vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Nikel PI, de Lorenzo V.
- Promoter:
- Pm
pBEXK vector Map
pBEXK vector Sequence
LOCUS 40924_6252 6495 bp DNA circular SYN 17-DEC-2018 DEFINITION Integrational vector pBEXK, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6495) AUTHORS Nikel PI, de Lorenzo V. TITLE Implantation of unmarked regulatory and metabolic modules in Gram-negative bacteria with specialised mini-transposon delivery vectors JOURNAL J. Biotechnol. 163 (2), 143-154 (2013) PUBMED 22609234 REFERENCE 2 (bases 1 to 6495) AUTHORS Nikel PI, de Lorenzo V. TITLE Direct Submission JOURNAL Submitted (11-FEB-2012) Systems Biology Program, Centro Nacional de Biotecnologia (CNB-CSIC), C/Darwin 3, Madrid, Madrid 28049, Spain REFERENCE 3 (bases 1 to 6495) TITLE Direct Submission REFERENCE 4 (bases 1 to 6495) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biotechnol."; date: "2013"; volume: "163"; issue: "2"; pages: "143-154" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-FEB-2012) Systems Biology Program, Centro Nacional de Biotecnologia (CNB-CSIC), C/Darwin 3, Madrid, Madrid 28049, Spain" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6495 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..19 /label=Tn5 ME /note="hyperactive mosaic end for Tn5 transposase recognition (Reznikoff et al., 2004)" CDS complement(41..1003) /codon_start=1 /label=XylS /note="XylS regulator encoded by the Pseudomonas putida TOL plasmid pWWO" /translation="MDFCLLNEKSQIFVHAEPYAVSDYVNQYVGTHSIRLPKGGRPAGR LHHRIFGCLDLCRISYGGSVRVISPGLETCYHLQIILKGHCLWRGHGQEHYFAPGELLL LNPDDQADLTYSEDCEKFIVKLPSVVLDRACSDNNWHKPREGIRFAARHNLQQLDGFIN LLGLVCDEAEHTKSMPRVQEHYAGIIASKLLEMLGSNVSREIFSKGNPSFERVVQFIEE NLKRNISLERLAELAMMSPRSLYNLFEKHAGTTPKNYIRNRKLESIRACLNDPSANVRS ITEIALDYGFLHLGRFAENYRSAFGELPSDTLRQCKKEVA" promoter 1903..1983 /label=Pm promoter /note="The bacterial Pm promoter is activated by XylS in the presence of benzoate or m-toluate (Marques et al., 1999)." misc_feature 2033..2089 /label=MCS /note="pUC18/19 multiple cloning site" terminator 2094..2188 /label=lambda t0 terminator /note="transcription terminator from phage lambda" protein_bind 2199..2246 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." CDS complement(2260..3072) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" misc_feature 3174..3221 /label=FRT /note="FRT" protein_bind 3174..3221 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." misc_feature complement(3228..3246) /label=Tn5 ME /note="hyperactive mosaic end for Tn5 transposase recognition (Reznikoff et al., 2004)" CDS 3340..4767 /codon_start=1 /label=Tn5 transposase /note="transposase from the bacterial Tn5 transposon (Reznikoff, 1993)" /translation="MITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKS ITISSEGSKAMQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQEFPELLAIEDTTSLSYR HQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPADADEKESG KWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGL YLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNA VLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAER QRMEEPDNLERMVSILSFVAVRLLQLRESFTPPQALRAQGLLKEAEHVESQSAETVLTP DECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQS KLDGFLAAKDLMAQGIKI" promoter 4824..4915 /label=AmpR promoter CDS 4916..5773 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" terminator 5780..5819 /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" oriT 5966..6074 /label=oriT /note="incP origin of transfer" rep_origin 6093..6481 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.