Basic Vector Information
- Vector Name:
- pBELK
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5964 bp
- Type:
- Integrational vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Nikel PI, de Lorenzo V.
pBELK vector Map
pBELK vector Sequence
LOCUS 40924_6177 5964 bp DNA circular SYN 17-DEC-2018 DEFINITION Integrational vector pBELK, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5964) AUTHORS Nikel PI, de Lorenzo V. TITLE Implantation of unmarked regulatory and metabolic modules in Gram-negative bacteria with specialised mini-transposon delivery vectors JOURNAL J. Biotechnol. 163 (2), 143-154 (2013) PUBMED 22609234 REFERENCE 2 (bases 1 to 5964) AUTHORS Nikel PI, de Lorenzo V. TITLE Direct Submission JOURNAL Submitted (11-FEB-2012) Systems Biology Program, Centro Nacional de Biotecnologia (CNB-CSIC), C/Darwin 3, Madrid, Madrid 28049, Spain REFERENCE 3 (bases 1 to 5964) TITLE Direct Submission REFERENCE 4 (bases 1 to 5964) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biotechnol."; date: "2013"; volume: "163"; issue: "2"; pages: "143-154" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-FEB-2012) Systems Biology Program, Centro Nacional de Biotecnologia (CNB-CSIC), C/Darwin 3, Madrid, Madrid 28049, Spain" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5964 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..19 /label=Tn5 ME /note="hyperactive mosaic end for Tn5 transposase recognition (Reznikoff et al., 2004)" promoter 30..107 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 108..1187 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter 1422..1451 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 1459..1475 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 1502..1558 /label=MCS /note="pUC18/19 multiple cloning site" terminator 1563..1657 /label=lambda t0 terminator /note="transcription terminator from phage lambda" protein_bind 1668..1715 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." CDS complement(1729..2541) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" misc_feature 2643..2690 /label=FRT /note="FRT" protein_bind 2643..2690 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." misc_feature complement(2697..2715) /label=Tn5 ME /note="hyperactive mosaic end for Tn5 transposase recognition (Reznikoff et al., 2004)" CDS 2809..4236 /codon_start=1 /label=Tn5 transposase /note="transposase from the bacterial Tn5 transposon (Reznikoff, 1993)" /translation="MITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKS ITISSEGSKAMQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQEFPELLAIEDTTSLSYR HQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPADADEKESG KWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGL YLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNA VLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAER QRMEEPDNLERMVSILSFVAVRLLQLRESFTPPQALRAQGLLKEAEHVESQSAETVLTP DECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQS KLDGFLAAKDLMAQGIKI" promoter 4293..4384 /label=AmpR promoter CDS 4385..5242 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 5249..5288 /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" oriT 5435..5543 /label=oriT /note="incP origin of transfer" rep_origin 5562..5950 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.