Basic Vector Information
- Vector Name:
- pBCGL1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8202 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Govan VA, Christensen ND, Berkower C, Jacobs WR Jr., Williamson A-L.
pBCGL1 vector Map
pBCGL1 vector Sequence
LOCUS V009246 8202 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009246 VERSION V009246 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8202) AUTHORS Govan VA, Christensen ND, Berkower C, Jacobs WR Jr., Williamson A-L. TITLE Recombinant BCG expressing cottontail rabbit papillomavirus (CRPV) L1 gene provides partial protection in rabbits challenged against CRPV JOURNAL Unpublished REFERENCE 2 (bases 1 to 8202) AUTHORS Govan VA, Christensen ND, Berkower C, Jacobs WR Jr., Williamson A-L. TITLE Direct Submission JOURNAL Submitted (02-MAR-2005) Division of Medical Virology, Institute of Infectious Diseases and Molecular Medicine, Anzio Road, Observatory, Cape Town 7925, South Africa REFERENCE 3 (bases 1 to 8202) TITLE Direct Submission REFERENCE 4 (bases 1 to 8202) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-MAR-2005) Division of Medical Virology, Institute of Infectious Diseases and Molecular Medicine, Anzio Road, Observatory, Cape Town 7925, South Africa" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8202 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1877..2689 /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin 3024..3612 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 5698..6330 /gene="tmk" /label="Thymidylate kinase" /note="Thymidylate kinase from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Accession#: P9WKE1" CDS 6556..8073 /codon_start=1 /gene="L1" /product="CRPV L1 major capsid protein" /label="L1" /note="derived from cottontail rabbit papillomavirus" /protein_id="AAX37308.1" /translation="MAVWLSTQNKFYLPPQPVTKIPSTDEYVTRTNVFYYASSDRLLTV GHPYYEIRDKGTMLVPKVSPNQYRVFRIKLPDPNKFAFGDKQLYDPEKERLVWCLRGIE VNRGQPLGVSVTGNPIFNKFDDVENPTKYYNNHADQQDYRKSMAFDPKQVQLLMLGCVP ATGEHWAQAKQCAEDPPQQTDCPPIELVNTVIEDGDMCEIGFGAMDHKTLQASLSEVPL ELAQSISKYPDYLKMQKDQFGDSMFFYARREQMYARHFFSRAGGDKENVKSRAYIKRTQ MQGEANANIATDNYCITPSGSLVSSDSQVFNRAYWLQKAQGMNNGVCWDNQIFVTVVDN TRGTILSLVTKSKEQIKKTHGKTVHFSSYLRHVEEYELQFVLQLCKVKLTPENLSYLHS MHPTIIDNWQLSVSAQPSGTLEDQYRYLQSIATKCPPPEPPKENTDPYKNYKFWEVDLS EKLSDQLDQYPLGRKFLNQSGLQRIGTKRPAPAPVSIVKSSKRKRRT" gene 6556..8073 /gene="L1" /label="L1" terminator 8120..8166 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.