Basic Vector Information
- Vector Name:
- pBBR1MCS-Erm
- Length:
- 4811 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Yero D, Ferrer-Navarro M, Costenaro L, Planell R, Conchillo-Sole O, Sole M, Roca I, Gibert I, Daura X.
pBBR1MCS-Erm vector Vector Map
pBBR1MCS-Erm vector Sequence
LOCUS V009255 4811 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009255 VERSION V009255 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4811) AUTHORS Yero D, Ferrer-Navarro M, Costenaro L, Planell R, Conchillo-Sole O, Sole M, Roca I, Gibert I, Daura X. TITLE A transport system associated with the intrinsic antimicrobial multiresistance in Pseudomonas aeruginosa JOURNAL Unpublished REFERENCE 2 (bases 1 to 4811) AUTHORS Yero D, Gibert I. TITLE Direct Submission JOURNAL Submitted (20-DEC-2016) Genetica Molecular Bacteriana, Institut de Biotecnologia i de Biomedicina (IBB), Campus UAB, Bellaterra, Barcelona 08191, Spain REFERENCE 3 (bases 1 to 4811) TITLE Direct Submission REFERENCE 4 (bases 1 to 4811) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-DEC-2016) Genetica Molecular Bacteriana, Institut de Biotecnologia i de Biomedicina (IBB), Campus UAB, Bellaterra, Barcelona 08191, Spain" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4811 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 100..116 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 126..144 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 153..260 /label="MCS" /note="pBluescript multiple cloning site" CDS 402..1136 /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" CDS complement(1556..2548) /codon_start=1 /gene="mob" /product="Mob" /function="required for plasmid mobilization" /label="mob" /protein_id="ATW75321.1" /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHL" gene complement(1556..2548) /gene="mob" /label="mob" rep_origin 2772..3541 /label="pBBR1 oriV" /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 3542..4201 /label="pBBR1 Rep" /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica"
This page is informational only.