pBBR1-mdh vector (V009262)

Basic Vector Information

Vector Name:
pBBR1-mdh
Antibiotic Resistance:
Chloramphenicol
Length:
5619 bp
Type:
Cloning vector
Replication origin:
pBBR1 oriV
Source/Author:
Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
Promoter:
trc

pBBR1-mdh vector Map

pBBR1-mdh5619 bp60012001800240030003600420048005400trc promoterlac operatorMalate dehydrogenaseMCSrrnB T1 terminatorrrnB T2 terminatorCAP binding siteCmRcat promoterMobpBBR1 oriVpBBR1 Rep

pBBR1-mdh vector Sequence

LOCUS       V009262                 5619 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V009262
VERSION     V009262
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5619)
  AUTHORS   Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
  TITLE     Repurposing type III polyketide synthase as a malonyl-CoA biosensor
            for metabolic engineering in bacteria
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. (2018) In press
   PUBMED   30232266
REFERENCE   2  (bases 1 to 5619)
  AUTHORS   Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
  TITLE     Novel Enzyme-coupled Malonyl-CoA Biosensor based on Type III
            Polyketide Synthase and Use of the same (KR 10-2018-0066323)
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 5619)
  AUTHORS   Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JUL-2018) Dept. Chemical and Biomolecular Engineering,
            Korea Advanced Institute of Science and Technology, Daehak-ro 291,
            Daejeon 34141, South Korea
REFERENCE   4  (bases 1 to 5619)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 5619)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A. (2018) In press"
            SGRef: number: 2; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (19-JUL-2018) Dept. Chemical and Biomolecular Engineering, Korea
            Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon
            34141, South Korea"
            SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5619
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        2..31
                     /label="trc promoter"
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    39..55
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             76..1011
                     /gene="mdh"
                     /label="Malate dehydrogenase"
                     /note="Malate dehydrogenase from Escherichia coli O6:H1
                     (strain CFT073 / ATCC 700928 / UPEC). Accession#: P61890"
     misc_feature    1017..1072
                     /label="MCS"
                     /note="pUC18/19 multiple cloning site"
     terminator      1275..1361
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      1453..1480
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     protein_bind    complement(1501..1522)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     CDS             complement(1636..2268)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(2269..2371)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             complement(2521..3540)
                     /codon_start=1
                     /gene="mob"
                     /product="Mob"
                     /function="required for plasmid mobilization"
                     /label="mob"
                     /protein_id="AYD60189.1"
                     /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
                     AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
                     DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
                     DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
                     VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
                     LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS"
     gene            complement(2521..3540)
                     /gene="mob"
                     /label="mob"
     rep_origin      3764..4535
                     /label="pBBR1 oriV"
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1
                     Rep protein for replication"
     CDS             4536..5195
                     /label="pBBR1 Rep"
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"

This page is informational only.