Basic Vector Information
- Vector Name:
- pBAD322T
- Antibiotic Resistance:
- Tetracycline
- Length:
- 4894 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Cronan JE.
- Promoter:
- araBAD
pBAD322T vector Map
pBAD322T vector Sequence
LOCUS 40924_5854 4894 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pBAD322T, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4894) AUTHORS Cronan JE. TITLE A family of arabinose-inducible Escherichia coli expression vectors having pBR322 copy control JOURNAL Plasmid 55 (2), 152-157 (2006) PUBMED 16139359 REFERENCE 2 (bases 1 to 4894) AUTHORS Cronan JE. TITLE Direct Submission JOURNAL Submitted (07-JUL-2005) Microbiology, University of Illinois, 601 S. Goodwin Ave., Urbana, IL 61801, USA REFERENCE 3 (bases 1 to 4894) TITLE Direct Submission REFERENCE 4 (bases 1 to 4894) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2006"; volume: "55"; issue: "2"; pages: "152-157" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-JUL-2005) Microbiology, University of Illinois, 601 S. Goodwin Ave., Urbana, IL 61801, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4894 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(99..974) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 1001..1285 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" terminator 1569..1655 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1747..1774 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" CDS complement(1940..3127) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(3175..3204) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" rep_origin 3292..3880 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4066..4206) /label=bom /note="basis of mobility region from pBR322" CDS complement(4311..4499) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL"
This page is informational only.