Basic Vector Information
- Vector Name:
- pBAD24-sfGFPx2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5257 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Malagon F.
- Promoter:
- araBAD
pBAD24-sfGFPx2 vector Vector Map
pBAD24-sfGFPx2 vector Sequence
LOCUS 40924_5814 5257 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBAD24-sfGFPx2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5257) AUTHORS Malagon F. TITLE Direct Submission JOURNAL Submitted (07-MAY-2013) Laboratory of Molecular Biology, National Cancer Institute, Convent Drive, Building 37, Room 5138, Bethesda, MD 20892-4255, USA REFERENCE 2 (bases 1 to 5257) TITLE Direct Submission REFERENCE 3 (bases 1 to 5257) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (07-MAY-2013) Laboratory of Molecular Biology, National Cancer Institute, Convent Drive, Building 37, Room 5138, Bethesda, MD 20892-4255, USA" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..5257 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(99..974) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 1001..1285 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" CDS 1339..2049 /codon_start=1 /label=superfolder GFP /note="GFP variant that folds robustly even when fused to poorly folded proteins (Pedelacq et al., 2006)" /translation="RKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKF ICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGT YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKAN FKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEF VTAAGITHGMDELYK" terminator 2284..2370 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2462..2489 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2508..2599 /label=AmpR promoter CDS 2600..3457 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 3502..3957 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 4068..4656 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.