Basic Vector Information
- Vector Name:
- pBAD24-Gluc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5013 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wille T, Blank K, Schmidt C, Vogt V, Gerlach RG.
- Promoter:
- araBAD
pBAD24-Gluc vector Vector Map
pBAD24-Gluc vector Sequence
LOCUS 40924_5799 5013 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBAD24-Gluc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5013) AUTHORS Wille T, Blank K, Schmidt C, Vogt V, Gerlach RG. TITLE Gaussia princeps Luciferase as a Reporter for Transcriptional Activity, Protein Secretion, and Protein-Protein Interactions in Salmonella enterica Serovar Typhimurium JOURNAL Appl. Environ. Microbiol. 78 (1), 250-257 (2012) PUBMED 22020521 REFERENCE 2 (bases 1 to 5013) AUTHORS Wille T, Blank K, Schmidt C, Gerlach RG. TITLE Direct Submission JOURNAL Submitted (19-MAY-2010) Junior Research Group 3, Robert Koch-Institute, Burgstrasse 37, Wernigerode, Saxony-Anhalt 38855, Germany REFERENCE 3 (bases 1 to 5013) TITLE Direct Submission REFERENCE 4 (bases 1 to 5013) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2012"; volume: "78"; issue: "1"; pages: "250-257" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-MAY-2010) Junior Research Group 3, Robert Koch-Institute, Burgstrasse 37, Wernigerode, Saxony-Anhalt 38855, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5013 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(99..974) /label=araC /note="L-arabinose regulatory protein" promoter 1001..1285 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" regulatory 1306..1311 /regulatory_class="ribosome_binding_site" CDS 1319..1828 /codon_start=1 /gene="Gluc" /product="Gluc" /label=Gluc /note="luciferase; derived from Gaussia princeps; codon optimized for Salmonella enterica expression" /protein_id="AEA02464.1" /translation="MKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEME ANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPG FKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKI KGAGGD" gene 1319..1828 /gene="Gluc" /label=Gluc terminator 2040..2126 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2218..2245 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2264..2355 /label=AmpR promoter CDS 2356..3213 /label=AmpR /note="beta-lactamase" rep_origin 3258..3713 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 3824..4412 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.