Basic Vector Information
- Vector Name:
- pBAD22A
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4540 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Okamoto S, Niki H.
- Promoter:
- araBAD
pBAD22A vector Map
pBAD22A vector Sequence
LOCUS 40924_5794 4540 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pBAD22A DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4540) AUTHORS Okamoto S, Niki H. TITLE NBRP cloning vector collection sequence project JOURNAL Unpublished REFERENCE 2 (bases 1 to 4540) AUTHORS Okamoto S, Niki H. TITLE Direct Submission JOURNAL Submitted (06-APR-2017) Contact:Sho Okamoto National Institute of Genetics, Microbial Genetics Laboratory; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL :https://www.nig.ac.jp/labs/MicroGen/index.html REFERENCE 3 (bases 1 to 4540) TITLE Direct Submission REFERENCE 4 (bases 1 to 4540) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-APR-2017) Contact:Sho Okamoto National Institute of Genetics, Microbial Genetics Laboratory; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL :https://www.nig.ac.jp/labs/MicroGen/index.html" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4540 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(99..974) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 1001..1285 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" terminator 1569..1655 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1747..1774 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 1793..1884 /label=AmpR promoter CDS 1885..2742 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 2787..3242 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 3353..3941 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.