pBACOV vector (V009316)

LOCUS       40924_5654        5396 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector pBACOV, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5396)
  AUTHORS   Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W.
  TITLE     Conjugative transfer of a new broad host range expression vector to 
            various Bacillus species using a single protocol
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5396)
  AUTHORS   Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-DEC-2017) Department for Microbiology, Technical 
            University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, 
            Germany
REFERENCE   3  (bases 1 to 5396)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5396)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (01-DEC-2017) Department for Microbiology, Technical University of 
            Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5396
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(79..667)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(841..1698)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(1699..1803)
                     /label=AmpR promoter
     CDS             complement(1832..2116)
                     /codon_start=1
                     /gene="traJ"
                     /product="TraJ"
                     /label=traJ
                     /protein_id="AWI97856.1"
                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
                     GQGYKITGVVDYEHVRELARINGDLGQQKAHYVNHHPNQVFWGRGAVKH"
     gene            complement(1832..2116)
                     /gene="traJ"
                     /label=traJ
                     /note="required for conjugation"
     oriT            complement(2149..2258)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     CDS             complement(2515..3276)
                     /codon_start=1
                     /gene="kanR"
                     /product="kanamycin resistance protein"
                     /label=kanR
                     /note="KanR"
                     /protein_id="AWI97857.1"
                     /translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD
                     GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF
                     SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP
                     SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK
                     LLESLENFWNGIQEWTERHGYIVDVSKRIPF"
     gene            complement(2515..3276)
                     /gene="kanR"
                     /label=kanR
                     /note="for selection in Bacillus"
     CDS             complement(3448..4449)
                     /label=repB
                     /note="RepB replication protein"
     regulatory      4866..5031
                     /label=aprE promoter from Bacillus subtilis
                     /note="aprE promoter from Bacillus subtilis"
                     /regulatory_class="promoter"
     regulatory      4960..4969
                     /regulatory_class="minus_35_signal"
     regulatory      4987..4992
                     /regulatory_class="minus_10_signal"
     regulatory      5042..5046
                     /regulatory_class="ribosome_binding_site"
     misc_feature    5057..5143
                     /note="aprE signal peptide from Bacillus subtilis for
                     secretory protein expression; aprE-SP"
     misc_feature    5156..5215
                     /label=multiple cloning site (MCS)
                     /note="multiple cloning site (MCS)"
     CDS             5216..5233
                     /label=6xHis
                     /note="6xHis affinity tag"