Basic Vector Information
- Vector Name:
- pBACOV-SPLipB-cel8A
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6680 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P.
pBACOV-SPLipB-cel8A vector Vector Map
pBACOV-SPLipB-cel8A vector Sequence
LOCUS 40924_5649 6680 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pBACOV-SPLipB-cel8A, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6680) AUTHORS Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P. TITLE Efficient secretory heterologous enzyme production in the novel host Paenibacillus polymyxa by usage of its promoter sequences JOURNAL Unpublished REFERENCE 2 (bases 1 to 6680) AUTHORS Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P. TITLE Direct Submission JOURNAL Submitted (09-MAY-2018) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany REFERENCE 3 (bases 1 to 6680) TITLE Direct Submission REFERENCE 4 (bases 1 to 6680) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAY-2018) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6680 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(79..667) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(841..1698) /label=AmpR /note="beta-lactamase" promoter complement(1699..1803) /label=AmpR promoter CDS complement(1832..2116) /codon_start=1 /gene="traJ" /product="TraJ" /label=traJ /protein_id="AXF54472.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGQQKAHYVNHHPNQVFWGRGAVKH" gene complement(1832..2116) /gene="traJ" /label=traJ oriT complement(2149..2258) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(2515..3276) /codon_start=1 /gene="kanR" /product="KanR" /label=kanR /note="Kanamycin Resistance" /protein_id="AXF54473.1" /translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK LLESLENFWNGIQEWTERHGYIVDVSKRIPF" gene complement(2515..3276) /gene="kanR" /label=kanR CDS complement(3448..4449) /label=repB /note="RepB replication protein" regulatory 4866..5031 /label=aprE promoter from B. subtilis /note="aprE promoter from B. subtilis" /regulatory_class="promoter" CDS 5057..5140 /codon_start=1 /gene="SPLipB-Cel8A-His6" /product="LipB signal peptide" /label=SPLipB-Cel8A-His6 /protein_id="AXF54474.1" /translation="MKKVLMAFIICLSLILSVLAAPPSGAKA" CDS 6500..6517 /label=6xHis /note="6xHis affinity tag"
This page is informational only.