Basic Vector Information
- Vector Name:
- pBACOV-sfGFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5957 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W.
pBACOV-sfGFP vector Map
pBACOV-sfGFP vector Sequence
LOCUS 40924_5644 5957 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pBACOV-sfGFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5957) AUTHORS Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W. TITLE Conjugative transfer of a new broad host range expression vector to various Bacillus species using a single protocol JOURNAL Unpublished REFERENCE 2 (bases 1 to 5957) AUTHORS Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W. TITLE Direct Submission JOURNAL Submitted (04-DEC-2017) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany REFERENCE 3 (bases 1 to 5957) TITLE Direct Submission REFERENCE 4 (bases 1 to 5957) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-DEC-2017) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5957 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(79..667) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(841..1698) /label=AmpR /note="beta-lactamase" promoter complement(1699..1803) /label=AmpR promoter CDS complement(1832..2116) /codon_start=1 /gene="traJ" /product="TraJ" /label=traJ /protein_id="AWI97859.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGQQKAHYVNHHPNQVFWGRGAVKH" gene complement(1832..2116) /gene="traJ" /label=traJ /note="required for conjugation" oriT complement(2149..2258) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(2515..3276) /codon_start=1 /gene="kanR" /product="kanamycin resistance protein" /label=kanR /note="KanR" /protein_id="AWI97860.1" /translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK LLESLENFWNGIQEWTERHGYIVDVSKRIPF" gene complement(2515..3276) /gene="kanR" /label=kanR /note="for selection in Bacillus" CDS complement(3448..4449) /label=repB /note="RepB replication protein" regulatory 4866..5031 /label=aprE promoter from Bacillus subtilis /note="aprE promoter from Bacillus subtilis" /regulatory_class="promoter" regulatory 4960..4969 /regulatory_class="minus_35_signal" regulatory 4987..4992 /regulatory_class="minus_10_signal" CDS 5057..5770 /label=superfolder GFP /note="GFP variant that folds robustly even when fused to poorly folded proteins (Nager et al., 2011)" CDS 5777..5794 /label=6xHis /note="6xHis affinity tag"
This page is informational only.