Basic Vector Information
- Vector Name:
- pB5GWnR
- Antibiotic Resistance:
- Streptomycin
- Length:
- 12504 bp
- Type:
- Gateway vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Kamigaki A, Nito K, Hikino K, Goto-Yamada S, Nishimura M, Nakagawa T, Mano S.
- Promoter:
- CaMV35S(long)
pB5GWnR vector Map
pB5GWnR vector Sequence
LOCUS 40924_5349 12504 bp DNA circular SYN 17-DEC-2018 DEFINITION Gateway vector pB5GWnR DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12504) AUTHORS Kamigaki A, Nito K, Hikino K, Goto-Yamada S, Nishimura M, Nakagawa T, Mano S. TITLE Gateway Vectors for Simultaneous Detection of Multiple Protein-Protein Interactions in Plant Cells Using Bimolecular Fluorescence Complementation JOURNAL PLoS ONE 11 (8), E0160717 (2016) PUBMED 27490375 REFERENCE 2 (bases 1 to 12504) AUTHORS Mano S, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (10-JUL-2013) Contact:Shoji Mano National Institute for Basic Biology, Department of Cell Biology; 38 Nishigonaka, Myodaiji, Okazaki, Aichi 444-8585, Japan REFERENCE 3 (bases 1 to 12504) TITLE Direct Submission REFERENCE 4 (bases 1 to 12504) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2016"; volume: "11"; issue: "8"; pages: "E0160717" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-JUL-2013) Contact:Shoji Mano National Institute for Basic Biology, Department of Cell Biology; 38 Nishigonaka, Myodaiji, Okazaki, Aichi 444-8585, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT These colnes were obtained at our laboratory. FEATURES Location/Qualifiers source 1..12504 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(54..78) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 281..297 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 812..1157 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" protein_bind 1179..1303 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1340..1370 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1424..2080 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2425..2727 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2771..2895) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 2906..3403 /codon_start=1 /product="amino-terminal fragment of monomeric red fluorescent protein 1" /label=amino-terminal fragment of monomeric red fluore /note="nmrfp1" /protein_id="BAV44561.1" /translation="MEQKLISEEDLMASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGE GRPYEGTQTAKLKVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYLKLSFPEGFKW ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYP ED" CDS 2909..2938 /codon_start=1 /product="Myc (human c-Myc proto-oncogene) epitope tag" /label=Myc /translation="EQKLISEEDL" terminator 3425..3677 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(3711..3727) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3735..3751 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3759..3789) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3804..3825) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." terminator complement(3861..4113) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(4267..5289) /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGAFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK E" promoter complement(5341..5520) /label=NOS promoter /note="nopaline synthase promoter" misc_feature complement(6026..6050) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 6571..7359 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 7608..8196 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8382..8522) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8866..9060) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(9129..10199) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" CDS complement(10631..11257) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.