Basic Vector Information
- Vector Name:
- pAYE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4603 bp
- Type:
- Phagemid vector
- Replication origin:
- ori
- Source/Author:
- Yee A, Tan F-L., Ginsburg D.
pAYE vector Map
pAYE vector Sequence
LOCUS 40924_5159 4603 bp DNA circular SYN 17-DEC-2018 DEFINITION Phagemid vector pAYE, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4603) AUTHORS Yee A, Tan F-L., Ginsburg D. TITLE Functional display of platelet-binding VWF fragments on filamentous bacteriophage JOURNAL PLoS ONE 8 (9), E73518 (2013) PUBMED 24019925 REFERENCE 2 (bases 1 to 4603) AUTHORS Yee A, Tan F-L., Ginsburg D. TITLE Direct Submission JOURNAL Submitted (07-JUL-2013) Life Scieneces Institute, University of Michigan, 210 Washtenaw Ave, Ann Arbor, MI 48109, USA REFERENCE 3 (bases 1 to 4603) TITLE Direct Submission REFERENCE 4 (bases 1 to 4603) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2013"; volume: "8"; issue: "9"; pages: "E73518" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (07-JUL-2013) Life Scieneces Institute, University of Michigan, 210 Washtenaw Ave, Ann Arbor, MI 48109, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4603 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 96..200 /label=AmpR promoter CDS 201..1058 /label=AmpR /note="beta-lactamase" rep_origin 1232..1820 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2108..2129 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2144..2174 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2182..2198 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2206..2222 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2269..3723 /codon_start=1 /transl_except="(pos: 2326 .. 2328, aa: OTHER)" /product="VWF A1-pIII fusion protein" /label=VWF A1-pIII fusion protein /note="stop codon is suppressed in Eshcerichia coli containing the glnV mutation (supE)" /protein_id="AHB62418.1" /translation="MRVLLFLLLSLFMLPAFSA*PAGAPGGQEPGGLVVPPTDAPVSPT TLYVEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWV RVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKID RPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQA PENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVGGGRAAAAGAPVPYP DPLEPRAAQGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEK MANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAG SNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPYVFGAGKPYEFSIDCDKINLFRGV FAFLLYVATFMYVFSTFANILRNKES" sig_peptide 2269..3720 misc_feature 2326..2328 /label=amber stop /note="amber stop" primer_bind complement(3733..3749) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 3962..4417 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.