pAY201 vector (V009385)

Basic Vector Information

Vector Name:
pAY201
Antibiotic Resistance:
Kanamycin
Length:
12408 bp
Type:
Shuttle vector
Replication origin:
p15A ori
Host:
Yeast
Source/Author:
Scholz P, Haring V, Wittmann-Liebold B, Ashman K, Bagdasarian M, Scherzinger E.
Promoter:
URA3

pAY201 vector Map

pAY20112408 bp60012001800240030003600420048005400600066007200780084009000960010200108001140012000RSF1010 oriVMobCRSF1010 oriTRSF1010 RepBunknown protein Erepressor protein FRSF1010 RepCbeta-lactamase, C-terminus regionp15A oriKanRtransposon Tn3 resolvase, C-terminus regionAmpR promoterbeta-lactamase, N-terminus regiontet promoterTcRURA3 promoterURA3terminator region of URA3

pAY201 vector Sequence

LOCUS       40924_5149       12408 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector pAY201 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12408)
  AUTHORS   Scholz P, Haring V, Wittmann-Liebold B, Ashman K, Bagdasarian M, 
            Scherzinger E.
  TITLE     Complete nucleotide sequence and gene organization of the 
            broad-host-range plasmid RSF1010
  JOURNAL   Gene 75 (2), 271-288 (1989)
  PUBMED    2653965
REFERENCE   2  (bases 1 to 12408)
  AUTHORS   Nishikawa M, Suzuki K, Yoshida K.
  TITLE     Structural and functional stability of IncP plasmids during stepwise
            transmission by trans-kingdom mating: promiscuous conjugation of 
            Escherichia coli and Saccharomyces cerevisiae
  JOURNAL   Jpn. J. Genet. 65 (5), 323-334 (1990)
  PUBMED    2248784
REFERENCE   3  (bases 1 to 12408)
  AUTHORS   Nishikawa M, Suzuki K, Yoshida K.
  TITLE     DNA integration into recipient yeast chromosomes by trans-kingdom 
            conjugation between Escherichia coli and Saccharomyces cerevisiae
  JOURNAL   Curr. Genet. 21 (2), 101-108 (1992)
  PUBMED    1568253
REFERENCE   4  (bases 1 to 12408)
  AUTHORS   Nishikawa M, Moriguchi K, Suzuki K.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2009) Contact:Kazuki Moriguchi Hiroshima 
            University, Department of Biological Science, Graduate School of 
            Science; Kagamiyama 1-3-1, Higashi-Hiroshima, Hiroshima 739-8526, 
            Japan
REFERENCE   5  (bases 1 to 12408)
  TITLE     Direct Submission
REFERENCE   6  (bases 1 to 12408)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; 
            date: "1989"; volume: "75"; issue: "2"; pages: "271-288"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Jpn. J. 
            Genet."; date: "1990"; volume: "65"; issue: "5"; pages: "323-334"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Curr. 
            Genet."; date: "1992"; volume: "21"; issue: "2"; pages: "101-108"
COMMENT     SGRef: number: 4; type: "Journal Article"; journalName: "Submitted 
            (19-OCT-2009) Contact:Kazuki Moriguchi Hiroshima University, 
            Department of Biological Science, Graduate School of Science; 
            Kagamiyama 1-3-1, Higashi-Hiroshima, Hiroshima 739-8526, Japan"
COMMENT     SGRef: number: 5; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12408
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          9762..9869
                     /mol_type="other DNA"
                     /db_xref="taxon:2504"
                     /organism="Plasmid RSF1010"
     rep_origin      complement(396..790)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     CDS             complement(817..1101)
                     /codon_start=1
                     /gene="mobC"
                     /product="MobC"
                     /label=mobC
                     /protein_id="BAI47951.1"
                     /translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRK
                     VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
     gene            complement(817..1101)
                     /gene="mobC"
                     /label=mobC
     oriT            1132..1219
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             2048..2461
                     /codon_start=1
                     /gene="mobB"
                     /product="MobB"
                     /label=mobB
                     /protein_id="BAI47953.1"
                     /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQAS
                     EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
                     MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
     gene            2048..2461
                     /gene="mobB"
                     /label=mobB
     CDS             2458..3426
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             3490..3702
                     /codon_start=1
                     /product="unknown protein E"
                     /label=unknown protein E
                     /note="unknown protein E gene"
                     /protein_id="BAI47955.1"
                     /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
                     LNLDGCTLSLFREDKPFGPGKFLGD"
     CDS             3704..3910
                     /codon_start=1
                     /product="repressor protein F"
                     /label=repressor protein F
                     /note="repressor protein F gene"
                     /protein_id="BAI47956.1"
                     /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
                     EALRECLEELRAAQGGGSDPASA"
     CDS             3940..4776
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             4766..5614
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     misc_feature    5821..6137
                     /gene="bla"
                     /label=beta-lactamase, C-terminus region
                     /note="beta-lactamase, C-terminus region"
     gene            5821..6137
                     /gene="bla"
                     /label=bla
     rep_origin      6302..6847
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             7442..8254
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_feature    8544..9035
                     /gene="tnpR"
                     /label=transposon Tn3 resolvase, C-terminus region
                     /note="transposon Tn3 resolvase, C-terminus region"
     gene            8544..9035
                     /gene="tnpR"
                     /label=tnpR
     promoter        9113..9217
                     /label=AmpR promoter
     misc_feature    9218..9761
                     /gene="bla"
                     /label=beta-lactamase, N-terminus region
                     /note="beta-lactamase, N-terminus region"
     gene            9218..9761
                     /gene="bla"
                     /label=bla
     promoter        9879..9907
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein
                     gene"
     CDS             9955..11142
                     /label=TcR
                     /note="tetracycline efflux protein"
     promoter        11306..11526
                     /label=URA3 promoter
     CDS             11527..12327
                     /label=URA3
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     regulatory      12331..12408
                     /gene="URA3"
                     /label=terminator region of URA3
                     /note="terminator region of URA3"
                     /regulatory_class="terminator"

This page is informational only.