Basic Vector Information
- Vector Name:
- pAXT
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10639 bp
- Type:
- Chloroplast transformation vector
- Replication origin:
- ori
- Source/Author:
- Lu Y, Stegemann S, Agrawal S, Karcher D, Ruf S, Bock R.
pAXT vector Map
pAXT vector Sequence
LOCUS V009386 10639 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009386 VERSION V009386 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10639) AUTHORS Lu Y, Stegemann S, Agrawal S, Karcher D, Ruf S, Bock R. TITLE Horizontal Transfer of a Synthetic Metabolic Pathway between Plant Species JOURNAL Curr. Biol. (2017) In press PUBMED 28943084 REFERENCE 2 (bases 1 to 10639) AUTHORS Karcher D, Bock R. TITLE Direct Submission JOURNAL Submitted (01-AUG-2017) Organelle Biology, Biotechnology and Molecular Ecophysiology, Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, Potsdam, Brandenburg 14476, Germany REFERENCE 3 (bases 1 to 10639) TITLE Direct Submission REFERENCE 4 (bases 1 to 10639) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr. Biol. (2017) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-AUG-2017) Organelle Biology, Biotechnology and Molecular Ecophysiology, Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, Potsdam, Brandenburg 14476, Germany" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10639 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 36..54 /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" regulatory 73..201 /label="Prrn" /note="Prrn" /regulatory_class="promoter" 5'UTR 202..243 CDS 244..1758 /codon_start=1 /gene="Lyc" /product="lycopene beta-cyclase" /label="Lyc" /note="derived from daffodil" /protein_id="ATG32096.1" /translation="MDTLLRTHNRLELLYPLHELAKRHFLSPSPNPQNPNFKFFSRKPY QKKCRNGYIGVSSNQLLDLVPEIKKEHLEFDLPLYDPSKALTLDLAVVGGGPAGLAVAQ QVSEAGLSVVSIDPNPKLIWPNNYGVWVDEFEDMDLLDCLDATWSGAIVYVDDRSTKNL SRPYARVNRKNLKSKMMKKCVSNGVRFHQATVVKAMHEEEKSYLICSDGVTIDARVVLD ATGFSRCLVQYDKPYNPGYQVAYGILAEVEEHPFDVDKMVFMDWRDSHLNGKAELNERN AKIPTFLYAMPFSSNRIFLEETSLVARPGLKMEDIQERMVARLNHLGIRIKSIEEDERC VIPMGGPLPVIPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANSIVQYLVSDSGLSG NDLSADVWKDLWPIERRRQREFFCFGMDILLKLDLEGTRRFFDAFFDLEPRYWHGFLSS RLFLPELVPFGLSLFSHASNTCKLEIMAKGTLPLVNMINNLVQDRD" gene 244..1758 /gene="Lyc" /label="Lyc" /note="NpLyc" regulatory 1769..1918 /label="derived from Nicotiana tabacum rps16" /note="derived from Nicotiana tabacum rps16" /regulatory_class="terminator" misc_feature 1931..1980 /note="IEE; intercistronic expression element" CDS 2005..2739 /codon_start=1 /gene="crtW" /product="beta-carotene ketolase" /label="crtW" /note="derived from marine bacterium Brevundimonas" /protein_id="ATG32097.1" /translation="MTAAVAEPRIVPRQTWIGLTLAGMIVAGWGSLHVYGVYFHRWGTS SLVIVPAIVAVQTWLSVGLFIVAHDAMHGSLAPGRPRLNAAVGRLTLGLYAGFRFDRLK TAHHAHHAAPGTADDPDFYAPAPRAFLPWFLNFFRTYFGWREMAVLTALVLIALFGLGA RPANLLTFWAAPALLSALQLFTFGTWLPHRHTDQPFADAHHARSSGYGPVLSLLTCFHF GRHHEHHLTPWRPWWRLWRGES" gene 2005..2739 /gene="crtW" /label="crtW" /note="BsCrtW" regulatory 2746..2970 /label="derived from Nicotiana tabacum rbcL" /note="derived from Nicotiana tabacum rbcL" /regulatory_class="terminator" misc_feature 2976..3025 /note="IEE; intercistronic expression element" CDS 3045..3530 /codon_start=1 /gene="crtZ" /product="beta-carotene hydroxylase" /label="crtZ" /note="derived from marine bacterium Brevundimonas" /protein_id="ATG32098.1" /translation="MAWLTWIALFLTAFLGMEAFAWIMHRYVMHGFLWSWHRSHHEPHD HPLEKNDLFAVVFAAPAIVMVAVGLHLWPWALPVGLGITAYGMVYFFFHDGLVHRRFPT GFSGRSGFWTRRIQAHRLHHAVRTREGCVSFGFLWVRSARALKAELAQKRGSSSSGA" gene 3045..3530 /gene="crtZ" /label="crtZ" /note="BsCrtZ" regulatory 3537..3758 /label="derived from Chlamydomonas rbcL" /note="derived from Chlamydomonas rbcL" /regulatory_class="terminator" misc_feature complement(3792..3825) /label="loxP" /note="loxP" protein_bind 3792..3825 /label="loxP" /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." regulatory complement(3826..4233) /label="derived from Nicotiana tabacum psbA" /note="derived from Nicotiana tabacum psbA" /regulatory_class="terminator" CDS complement(4237..5025) /label="SmR" /note="aminoglycoside adenylyltransferase (Murphy, 1985)" regulatory complement(5026..5200) /note="Prrn; derived from Nicotiana tabacum" /regulatory_class="promoter" protein_bind complement(5201..5234) /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." tRNA complement(5427..5497) /gene="trnG" /product="tRNA-Gly" /label="trnG" gene complement(5427..5497) /gene="trnG" /label="trnG" misc_feature complement(5773..5903) /label="similar to psbZ" /note="similar to psbZ" promoter complement(5917..5935) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5956..5972) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 5980..5996 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6004..6034) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(6049..6070) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6358..6946) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7120..7977) /label="AmpR" /note="beta-lactamase" promoter complement(7978..8082) /label="AmpR promoter" rep_origin complement(8108..8563) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 8705..8721 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 8731..8749 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 8761..9961 /label="similar to psaB" /note="similar to psaB" CDS 10084..10383 /gene="rps14" /label="Small ribosomal subunit protein uS14c" /note="Small ribosomal subunit protein uS14c from Nicotiana sylvestris. Accession#: Q3C1I0" tRNA 10536..10609 /gene="trnfM" /product="tRNA-fMet" /label="trnfM" gene 10536..10609 /gene="trnfM" /label="trnfM"
This page is informational only.