Basic Vector Information
- Vector Name:
- pAW068
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 9406 bp
- Type:
- Transposon delivery vector
- Replication origin:
- ori
- Source/Author:
- Wilson AC, Perego M, Hoch JA.
pAW068 vector Vector Map
pAW068 vector Sequence
LOCUS V009387 9406 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009387 VERSION V009387 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9406) AUTHORS Wilson AC, Perego M, Hoch JA. TITLE New transposon delivery plasmids for insertional mutagenesis in Bacillus anthracis JOURNAL J. Microbiol. Methods 71 (3), 332-335 (2007) PUBMED 17931726 REFERENCE 2 (bases 1 to 9406) AUTHORS Wilson AC, Perego M, Hoch JA. TITLE Direct Submission JOURNAL Submitted (10-SEP-2007) Department of Molecular and Experimental, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 9406) TITLE Direct Submission REFERENCE 4 (bases 1 to 9406) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2007"; volume: "71"; issue: "3"; pages: "332-335" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-SEP-2007) Department of Molecular and Experimental, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9406 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 171..1217 /codon_start=1 /product="C9 transposase" /label="C9 transposase" /protein_id="ABV70027.1" /translation="MEKKEFRVLIKYCFLKGKNTVEAKTWLDNEFPDSAPGKSTIIDWY AKFKRGEMSTEDGERSGRPKEVVTDENIKKIHKMILNDRKMKLIEIAEALKISKERVGH IIHQYLDMRKLCAKWVPRELTFDQKQRRVDDSKRCLQLLTRNTPEFFRRYVTMDETWLH HYTPESNRQSAEWTATGEPSPKRGKTQKSAGKVMASVFWDAHGIIFIDYLEKGKTINSD YYMALLERLKVEIAAKRPHMKKKKVLFHQDNAPCHKSLRTMAKIHELGFELLPHPPYSP DLAPSDFFLFSDLKRMLAGKKFGCNEEVIAETEAYFEAKPKEYYQNGIKKLEGRYNRCI ALEGNYVE" promoter complement(1280..1298) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1635..1656 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 1671..1701 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 1709..1725 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1733..1749 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" promoter 1770..1788 /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" mobile_element 1801..1827 /mobile_element_type="transposon:mariner" /label="ner" CDS 1843..1908 /label="3xFLAG" /note="three tandem FLAG(R) epitope tags, followed by an enterokinase cleavage site" protein_bind 1912..1959 /label="FRT" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." promoter complement(1978..1996) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(2483..3071) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 3367..4146 /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" protein_bind 5051..5098 /label="FRT" /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." mobile_element complement(5112..5138) /mobile_element_type="transposon:mariner" /label="ner" promoter complement(5151..5169) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(5176..5192) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 5817..6464 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(7080..7778) /codon_start=1 /gene="repA" /product="RepA" /label="repA" /protein_id="ABV70030.1" /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK VLDAETGEIK" gene complement(7080..7778) /gene="repA" /label="repA" CDS 8390..8401 /label="Factor Xa site" /note="Factor Xa recognition and cleavage site"
This page is informational only.