Basic Vector Information
- Vector Name:
- pAW016
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 7352 bp
- Type:
- Transposon delivery vector
- Replication origin:
- ori
- Source/Author:
- Wilson AC, Perego M, Hoch JA.
pAW016 vector Map
pAW016 vector Sequence
LOCUS V009388 7352 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009388 VERSION V009388 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7352) AUTHORS Wilson AC, Perego M, Hoch JA. TITLE New transposon delivery plasmids for insertional mutagenesis in Bacillus anthracis JOURNAL J. Microbiol. Methods 71 (3), 332-335 (2007) PUBMED 17931726 REFERENCE 2 (bases 1 to 7352) AUTHORS Wilson AC, Perego M, Hoch JA. TITLE Direct Submission JOURNAL Submitted (10-SEP-2007) Department of Molecular and Experimental, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 7352) TITLE Direct Submission REFERENCE 4 (bases 1 to 7352) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2007"; volume: "71"; issue: "3"; pages: "332-335" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-SEP-2007) Department of Molecular and Experimental, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7352 /mol_type="other DNA" /organism="synthetic DNA construct" mobile_element 1..43 /mobile_element_type="transposon:mini-Tn10" /label="n10" rep_origin complement(320..908) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1204..1983 /gene="ant1" /label="Spectinomycin 9-adenylyltransferase" /note="Spectinomycin 9-adenylyltransferase from Staphylococcus aureus (strain N315). Accession#: P0A0D1" mobile_element complement(2308..2351) /mobile_element_type="transposon:mini-Tn10" /label="n10" CDS complement(2543..3190) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(3908..3919) /label="Factor Xa site" /note="Factor Xa recognition and cleavage site" CDS 4531..5229 /codon_start=1 /gene="repA" /product="RepA" /label="repA" /protein_id="ABV70025.1" /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE KKDKDTWNSSDVIRNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK VLDAETGEIK" gene 4531..5229 /gene="repA" /label="repA" CDS complement(5940..6878) /codon_start=1 /product="transposase" /label="transposase" /protein_id="ABV70026.1" /translation="MPIVLVDWSDIREQKRLMVLRASVALHGRSVTLYEKAFPLSEQCS KKAHDQFLADLASILPSNTTPLIVSDAGFKVPWYKSVEKLGWYWLSRVRGKVQYADLGA ENWKPISNLHDMSSSHSKTLGYKRLTKSNPISCQILLYKSRSKGRKNQRSTRTHCHHPS PKIYSASAKEPWVLATNLPVEIRTPKQLVNIYSKRMQIEETFRDLKSPAYGLGLRHSRT SSSERFDIMLLIALMLQLTCWLAGVHAQKQGWDKHFQANTVRNRNVLSTVRLGMEVLRH SGYTITREDLLVAATLLAQNLFTHGYALGKL" RBS 7155..7166 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" protein_bind complement(7207..7223) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.