Basic Vector Information
- Vector Name:
- paT7P-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5502 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Han T, Chen Q, Liu H.
paT7P-2 vector Vector Map
paT7P-2 vector Sequence
LOCUS 40924_4984 5502 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector paT7P-2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5502) AUTHORS Han T, Chen Q, Liu H. TITLE Engineered photoactivatable genetic switches based on the bacterium phage T7 RNA polymerase JOURNAL ACS Synth Biol (2016) In press PUBMED 27794600 REFERENCE 2 (bases 1 to 5502) AUTHORS Han T, Chen Q, Liu H. TITLE Direct Submission JOURNAL Submitted (11-OCT-2016) School of Life Sciences, University of Science and Technology of China, University of Science and Technology of China, No.96, JinZhai Road Baohe District,Hefei,Anhui, 230026,P.R.China, Hefei, Anhui 230026, China REFERENCE 3 (bases 1 to 5502) TITLE Direct Submission REFERENCE 4 (bases 1 to 5502) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth Biol (2016) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-OCT-2016) School of Life Sciences, University of Science and Technology of China, University of Science and Technology of China, No.96, JinZhai Road Baohe District,Hefei,Anhui, 230026,P.R.China, Hefei, Anhui 230026, China" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. Vector NTI Advance (TM) 11.0 Assembly Name :: paT7P-2 Coverage :: 5502bp Sequencing Technology :: 454 ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5502 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(73..116) /label=bacterial terminator /note="putative bacterial transcription terminator" regulatory 125..168 /regulatory_class="promoter" regulatory 179..190 /regulatory_class="ribosome_binding_site" RBS 179..190 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 1925..2374 /label=pMag /note="'positive Magnet' variant of an N-terminally truncated Vivid (VVD) blue light photoreceptor from Neurospora crassa (Kawano et al., 2015)" regulatory 2419..2430 /regulatory_class="ribosome_binding_site" RBS 2419..2430 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 2437..3399 /codon_start=1 /product="C565" /label=C565 /note="C565 fragment of T7 RNAP" /protein_id="APD28472.1" /translation="METVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEK VKLGTKALAGQWLAYGVTRSVTKRSVMTLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMF TQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILRKRCAVH WVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHS QDGSHLRKTVVWAHEKYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLAD FYDQFADQLHESQLDKMPALPAKGNLNLRDILESDFAFA" regulatory 3406..3439 /regulatory_class="terminator" misc_feature 3439..3459 /label=BioBrick suffix /note="universal suffix for all parts" terminator 3460..3517 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." rep_origin complement(3712..4300) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4536..5348) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.