paT7P-2 vector (V009411)

Basic Vector Information

Vector Name:
paT7P-2
Antibiotic Resistance:
Kanamycin
Length:
5502 bp
Type:
Expression vector
Replication origin:
ori
Source/Author:
Han T, Chen Q, Liu H.

paT7P-2 vector Vector Map

paT7P-25502 bp60012001800240030003600420048005400bacterial terminatorpMagC565BioBrick suffixhis operon terminatororiKanR

paT7P-2 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_4984        5502 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector paT7P-2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5502)
  AUTHORS   Han T, Chen Q, Liu H.
  TITLE     Engineered photoactivatable genetic switches based on the bacterium 
            phage T7 RNA polymerase
  JOURNAL   ACS Synth Biol (2016) In press
  PUBMED    27794600
REFERENCE   2  (bases 1 to 5502)
  AUTHORS   Han T, Chen Q, Liu H.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2016) School of Life Sciences, University of 
            Science and Technology of China, University of Science and 
            Technology of China, No.96, JinZhai Road Baohe District,Hefei,Anhui,
            230026,P.R.China, Hefei, Anhui 230026, China
REFERENCE   3  (bases 1 to 5502)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5502)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth 
            Biol (2016) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (11-OCT-2016) School of Life Sciences, University of Science and 
            Technology of China, University of Science and Technology of China, 
            No.96, JinZhai Road Baohe District,Hefei,Anhui, 230026,P.R.China, 
            Hefei, Anhui 230026, China"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTI v. Vector NTI Advance (TM) 11.0 
            Assembly Name         :: paT7P-2
            Coverage              :: 5502bp
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5502
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      complement(73..116)
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     regulatory      125..168
                     /regulatory_class="promoter"
     regulatory      179..190
                     /regulatory_class="ribosome_binding_site"
     RBS             179..190
                     /note="strong bacterial ribosome binding site (Elowitz and 
                     Leibler, 2000)"
     CDS             1925..2374
                     /label=pMag
                     /note="'positive Magnet' variant of an N-terminally
                     truncated Vivid (VVD) blue light photoreceptor from 
                     Neurospora crassa (Kawano et al., 2015)"
     regulatory      2419..2430
                     /regulatory_class="ribosome_binding_site"
     RBS             2419..2430
                     /note="strong bacterial ribosome binding site (Elowitz and 
                     Leibler, 2000)"
     CDS             2437..3399
                     /codon_start=1
                     /product="C565"
                     /label=C565
                     /note="C565 fragment of T7 RNAP"
                     /protein_id="APD28472.1"
                     /translation="METVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEK
                     VKLGTKALAGQWLAYGVTRSVTKRSVMTLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMF
                     TQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILRKRCAVH
                     WVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHS
                     QDGSHLRKTVVWAHEKYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLAD
                     FYDQFADQLHESQLDKMPALPAKGNLNLRDILESDFAFA"
     regulatory      3406..3439
                     /regulatory_class="terminator"
     misc_feature    3439..3459
                     /label=BioBrick suffix
                     /note="universal suffix for all parts"
     terminator      3460..3517
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E.
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     rep_origin      complement(3712..4300)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4536..5348)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"

This page is informational only.