Basic Vector Information
- Vector Name:
- pAS2-mABIN-1(388-647)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9363 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- ADH1(medium)
pAS2-mABIN-1(388-647) vector Map
pAS2-mABIN-1(388-647) vector Sequence
LOCUS V009444 9363 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V009444 VERSION V009444 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9363) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 9363) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 9363) TITLE Direct Submission REFERENCE 4 (bases 1 to 9363) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9363 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(2..1344) /direction=LEFT /label="2u ori" /note="yeast 2u plasmid origin of replication" promoter 1603..1883 /label="TRP1 promoter" CDS 1884..2555 /label="TRP1" /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" rep_origin complement(2661..3116) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 3261..3277 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" terminator complement(3314..3561) /label="CYC1 terminator" /note="transcription terminator for CYC1" CDS complement(3858..4304) /gene="RPL28" /label="Large ribosomal subunit protein uL15" /note="Large ribosomal subunit protein uL15 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c). Accession#: P02406" promoter 4769..5473 /label="ADH1 promoter" /note="promoter for alcohol dehydrogenase 1" CDS 5501..5941 /label="GAL4 DNA binding domain" /note="DNA binding domain of the GAL4 transcriptional activator" CDS 5957..5983 /label="HA" /note="HA (human influenza hemagglutinin) epitope tag" CDS 6008..6790 /codon_start=1 /note="unnamed protein product; mABIN-1(388-647)" /protein_id="SJL86780.1" /translation="EMEETDKEQLTAEAKELRQKVRYLQDQLSPLTRQREYQEKEIQRL NKALEEALSIQASPSSPPAAFGSPEGVGGHLRKQELVTQNELLKQQVKIFEEDFQRERS DRERMNEEKEELKKQVEKLQAQVTLTNAQLKTLKEEEKAKEALKQQKRKAKASGERYHM EPHPEHVCGAYPYAYPPMPAMVPHHAYKDWSQIRYPPPPVPMEHPPPHPNSRLFHLPEY TWRPPCAGIRNQSSQVMDPPPDRPAEPESADNDCDGPQ" terminator 7001..7188 /label="ADH1 terminator" /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" primer_bind complement(7212..7228) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7236..7252) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7260..7290) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(7305..7326) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(7614..8202) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8376..9233) /label="AmpR" /note="beta-lactamase" promoter complement(9234..9338) /label="AmpR promoter"
This page is informational only.