pARO191 vector (V009452)

Download GeneBank File(.gb)

LOCUS       40924_4759        5963 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pARO191 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5963)
  AUTHORS   Okamoto S.
  TITLE     cloning vector pARO191 sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5963)
  AUTHORS   Okamoto S, Niki H.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2016) Contact:Sho Okamoto National Institute of 
            Genetics, Microbial Genetics Laboratory, Genetics Strains Research 
            Center; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL 
            :https://www.nig.ac.jp/labs/MicroGen/
REFERENCE   3  (bases 1 to 5963)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5963)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (31-MAR-2016) Contact:Sho Okamoto National Institute of Genetics, 
            Microbial Genetics Laboratory, Genetics Strains Research Center; 
            1111 Yata, Mishima, Shizuoka 411-8540, Japan URL 
            :https://www.nig.ac.jp/labs/MicroGen/"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5963
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     925..941
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    942..998
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(1011..1027)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(1035..1051)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1059..1089)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(1104..1125)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      1413..2001
                     /label=pMB1 ori
                     /note="pMB1 ori"
     misc_feature    2427..2567
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(2753..3341)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4377..5189)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     oriT            complement(5443..5552)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     terminator      5604..5647
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"