Basic Vector Information
- Vector Name:
- pARAtrfA
- Antibiotic Resistance:
- Bleomycin
- Length:
- 7277 bp
- Type:
- Plasmid vector
- Replication origin:
- ori
- Source/Author:
- Kvitko BH, McMillan IA, Schweizer HP.
- Promoter:
- araBAD
pARAtrfA vector Vector Map
pARAtrfA vector Sequence
LOCUS 40924_4719 7277 bp DNA circular SYN 18-DEC-2018 DEFINITION Plasmid vector pARAtrfA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7277) AUTHORS Kvitko BH, McMillan IA, Schweizer HP. TITLE An improved method for the oriT-directed cloning and functionalization of large bacterial genomic regions JOURNAL Unpublished REFERENCE 2 (bases 1 to 7277) AUTHORS Kvitko BH, McMillan IA, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (23-AUG-2012) Microbiology Immunology and Pathology, Colorado State University, IDRC at Foothills Campus, Campus Delivery 0922, Fort Collins, CO 80523-0922, USA REFERENCE 3 (bases 1 to 7277) TITLE Direct Submission REFERENCE 4 (bases 1 to 7277) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-AUG-2012) Microbiology Immunology and Pathology, Colorado State University, IDRC at Foothills Campus, Campus Delivery 0922, Fort Collins, CO 80523-0922, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7277 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(44..874) /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYCLSVQEQRIVLASISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMGSTHAIRLYELLTQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKARKISDAEIAKQARPGETWEAARARLTQMPLDLA" rep_origin 888..1239 /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" promoter 1359..1406 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 1425..1796 /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" rep_origin 2080..2535 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 2646..3234 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3934..4809) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 4836..5120 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" protein_bind 5156..5180 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" RBS 5192..5212 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 5222..6367 /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" protein_bind complement(6387..6411) /label=attB2 /note="recombination site for the Gateway(R) BP reaction" terminator 6655..6741 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 6833..6860 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 6879..6970 /label=AmpR promoter
This page is informational only.