Basic Vector Information
- Vector Name:
- pARAn58
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6144 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Roth AH, Dersch P.
pARAn58 vector Map
pARAn58 vector Sequence
LOCUS 40924_4714 6144 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pARAn58, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6144) AUTHORS Roth AH, Dersch P. TITLE A novel expression system for intracellular production and purification of recombinant affinity-tagged proteins in Aspergillus niger JOURNAL Appl. Microbiol. Biotechnol. 86 (2), 659-670 (2010) PUBMED 19908039 REFERENCE 2 (bases 1 to 6144) AUTHORS Dersch P, Roth A. TITLE Direct Submission JOURNAL Submitted (27-MAR-2009) Institute of Microbiology, Technische Universitat Braunschweig, Spielmannstr. 7, Braunschweig 38106, Germany REFERENCE 3 (bases 1 to 6144) TITLE Direct Submission REFERENCE 4 (bases 1 to 6144) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Microbiol. Biotechnol."; date: "2010"; volume: "86"; issue: "2"; pages: "659-670" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-MAR-2009) Institute of Microbiology, Technische Universitat Braunschweig, Spielmannstr. 7, Braunschweig 38106, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6144 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..1194 /label=suc1 /note="suc1" /regulatory_class="promoter" regulatory 1245..2313 /label=gla /note="gla" /regulatory_class="terminator" primer_bind complement(2345..2361) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2831..2935 /label=AmpR promoter CDS 2936..3793 /label=AmpR /note="beta-lactamase" rep_origin 3967..4555 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS join(5217..5373,5433..6100) /codon_start=1 /gene="pyrG" /product="orotidine-5'-phosphate decarboxylase" /label=pyrG /protein_id="ACP41233.1" /translation="MSSKSHLPYAIRATNHPNPLTSKLFSIAEEKKTNVTVSADVTTSA ELLDLADRLGPYIAVLKTHIDILTDLTPSTLSSLQSLATKHNFLIFEDRKFIDIGNTVQ KQYHGGALRISEWAHIINCAILPGEGIVEALAQTTKSPDFKDANQRGLLILAEMTSKGS LATGEYTARSVEYARKYKGFVMGFVSTRALSEVLPEQKEESEDFVVFTTGVNLSDKGDK LGQQYQTPGSAVGRGADFIIAGRGIYKADDPVEAVQRYREEGWKAYEKRVGL" gene 5217..6100 /gene="pyrG" /label=pyrG
This page is informational only.