pAPn vector (V009467)

Download GeneBank File(.gb)

LOCUS       40924_4684       10530 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pAPn, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10530)
  AUTHORS   Zare B, Malboobi MA, Sabet MS, Norouzi P.
  TITLE     High plant transformation efficiency using a new chimeric P-DNA 
            derived from sugar beet
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10530)
  AUTHORS   Zare B, Malboobi MA, Sabet MS, Norouzi P.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAY-2015) Plant Biotechnology, NIGEB, Pajoohesh Blvd.,
            Tehran 009821, Iran
REFERENCE   3  (bases 1 to 10530)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10530)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (26-MAY-2015) Plant Biotechnology, NIGEB, Pajoohesh Blvd., Tehran 
            009821, Iran"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10530
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     oriT            140..249
                     /label=oriT
                     /note="incP origin of transfer"
     mobile_element  309..1076
                     /label=IS1
                     /note="prokaryotic transposable element"
     CDS             1076..1426
                     /label=traJ
                     /note="oriT-recognizing protein"
     CDS             1701..2846
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     rep_origin      complement(4209..4797)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             5894..6682
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy,
                     1985)"
                     /label=SmR
                     /note="confers resistance to spectinomycin and
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      complement(7287..7999)
                     /direction=LEFT
                     /label=oriV
                     /note="incP origin of replication"
     misc_feature    7999..8307
                     /label=PB, a new chimeric P-DNA derived from sugar beet
                     /note="PB, a new chimeric P-DNA derived from sugar beet"
     misc_feature    7999..8112
                     /label=ACR region of pTiC58
                     /note="ACR region of pTiC58"
     promoter        complement(8347..8365)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(8372..8388)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        8546..8729
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             8730..9548
                     /label=KanR
                     /note="fusion between an N-terminal peptide of nopaline
                     synthase and Tn5 aminoglycoside phosphotransferase"
     regulatory      9552..10393
                     /gene="nos"
                     /regulatory_class="terminator"
     gene            9552..10393
                     /gene="nos"
                     /label=nos
                     /note="nopaline synthase"
     misc_feature    10394..10487
                     /label=PB, a new chimeric P-DNA derived from sugar beet
                     /note="PB, a new chimeric P-DNA derived from sugar beet"
     misc_feature    10488..10530
                     /label=C-clusters region of pTiC58
                     /note="C-clusters region of pTiC58"