Basic Vector Information
- Vector Name:
- pAP322
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6491 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Park AS, Rubin EJ, Minch KJ, Sherman DR.
pAP322 vector Map
pAP322 vector Sequence
LOCUS V009472 6491 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V009472 VERSION V009472 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6491) AUTHORS Park AS, Rubin EJ, Minch KJ, Sherman DR. TITLE Clp-mediated Regulation of WhiB1 is Required for Cell Division in Mycobacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 6491) AUTHORS Park AS, Rubin EJ, Minch KJ, Sherman DR. TITLE Direct Submission JOURNAL Submitted (18-JUL-2017) Department of Immunology and Infectious Diseases, Harvard School of Public Health, 665 Huntington Ave, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 6491) TITLE Direct Submission REFERENCE 4 (bases 1 to 6491) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-JUL-2017) Department of Immunology and Infectious Diseases, Harvard School of Public Health, 665 Huntington Ave, Boston, MA 02115, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6491 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..38 /regulatory_class="terminator" CDS complement(73..693) /label="TetR" /note="tetracycline repressor TetR" regulatory complement(720..1036) /regulatory_class="promoter" terminator complement(1055..1082) /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" rep_origin complement(1264..1852) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2187..2999) /label="KanR" /note="aminoglycoside phosphotransferase" CDS complement(3283..4395) /gene="33" /label="Integrase" /note="Integrase from Mycobacterium phage L5. Accession#: P22884" terminator complement(4942..4988) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 5034..5061 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" regulatory 5086..5391 /regulatory_class="promoter" protein_bind 5261..5278 /gene="tetO" /label="tet operator" /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O2 for the tetR and tetA genes" regulatory 5407..5412 /regulatory_class="ribosome_binding_site" CDS 5438..5455 /label="6xHis" /note="6xHis affinity tag" CDS 5468..6181 /label="EGFP" /note="enhanced GFP" CDS 6191..6442 /codon_start=1 /product="WhiB1" /label="WhiB1" /note="WhiB1 from Mycobacterium smegmatis str. MC2 155" /protein_id="ASU06035.1" /translation="DWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTEC LSWALESGQDAGVWGGMSEDERRALKRRNARTKARTGV"
This page is informational only.