Basic Vector Information
- Vector Name:
- pAP151
- Antibiotic Resistance:
- Tetracycline
- Length:
- 8772 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Park AS, Rubin EJ.
pAP151 vector Map
pAP151 vector Sequence
LOCUS V009488 8772 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V009488 VERSION V009488 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8772) AUTHORS Park AS, Rubin EJ. TITLE Clp-mediated Regulation of WhiB1 is Required for Cell Division in Mycobacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 8772) AUTHORS Park AS, Rubin EJ. TITLE Direct Submission JOURNAL Submitted (11-JUL-2017) Department of Immunology and Infectious Diseases, Harvard School of Public Health, 665 Huntington Ave, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 8772) TITLE Direct Submission REFERENCE 4 (bases 1 to 8772) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JUL-2017) Department of Immunology and Infectious Diseases, Harvard School of Public Health, 665 Huntington Ave, Boston, MA 02115, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8772 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(37..83) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 359..375 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 395..415 /label="attB4" /note="core recombination site for the Gateway(R) BP reaction" CDS complement(451..1074) /codon_start=1 /product="TetR" /label="TetR" /note="Tet repressor protein" /protein_id="AWN08190.1" /translation="MSRLDKSKVINSALALGNEVGIEGVTTRKLAQKLGVAQKTLYWHV KNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTR PDEKQYDTVETQLRFMTENGFSLENALYALSAVGHFTLGCVLEDQEHTAAKEERETPTT DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS" regulatory complement(1107..1600) /regulatory_class="promoter" protein_bind 1600..1624 /label="attB1" /note="recombination site for the Gateway(R) BP reaction" protein_bind complement(1799..1823) /label="attB2" /note="recombination site for the Gateway(R) BP reaction" CDS 1838..4381 /gene="clpC1" /label="ATP-dependent Clp protease ATP-binding subunit ClpC1" /note="ATP-dependent Clp protease ATP-binding subunit ClpC1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Accession#: P9WPC9" polyA_signal 4801..4935 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" rep_origin complement(5131..5719) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6054..6866) /label="KanR" /note="aminoglycoside phosphotransferase" CDS complement(7150..8262) /gene="33" /label="Integrase" /note="Integrase from Mycobacterium phage L5. Accession#: P22884"
This page is informational only.