Basic Vector Information
- Vector Name:
- pAMG258
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8662 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Olson DG.
- Promoter:
- URA3
pAMG258 vector Map
pAMG258 vector Sequence
LOCUS V009509 8662 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009509 VERSION V009509 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8662) AUTHORS Olson DG. TITLE Transformation of Clostridium thermocellum by electroporation JOURNAL Unpublished REFERENCE 2 (bases 1 to 8662) AUTHORS Olson DG. TITLE Direct Submission JOURNAL Submitted (19-OCT-2011) Thayer School of Engineering, Dartmouth College, 8000 Cummings, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8662) TITLE Direct Submission REFERENCE 4 (bases 1 to 8662) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-OCT-2011) Thayer School of Engineering, Dartmouth College, 8000 Cummings, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8662 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 11..514 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" regulatory 692..1339 /gene="GapDH" /regulatory_class="promoter" gene 692..1339 /gene="GapDH" /label="GapDH" CDS 1340..1987 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 2008..2553 /codon_start=1 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="AFC37773.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 2008..2553 /gene="hpt" /label="hpt" terminator 2663..2910 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(3158..3746) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3833..4411) /codon_start=1 /gene="tdk" /product="thymidine kinase" /label="tdk" /protein_id="AFC37774.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(3833..4411) /gene="tdk" /label="tdk" regulatory complement(4412..5032) /gene="Cbp" /regulatory_class="promoter" gene complement(4412..5032) /gene="Cbp" /label="Cbp" CDS complement(5111..6112) /label="repB" /note="RepB replication protein" rep_origin complement(6113..6567) /direction=LEFT /label="cth ori" /note="cth ori" CDS complement(6673..7530) /label="AmpR" /note="beta-lactamase" CDS complement(7629..8429) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(8430..8645) /label="URA3 promoter"
This page is informational only.