Basic Vector Information
- Vector Name:
- pAM1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6245 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pAM1 vector Vector Map
pAM1 vector Sequence
LOCUS V009520 6245 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009520 VERSION V009520 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6245) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6245) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6245) TITLE Direct Submission REFERENCE 4 (bases 1 to 6245) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6245 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS complement(502..1233) /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" CDS 1698..1982 /codon_start=1 /note="unnamed protein product; copG-like" /protein_id="SJL86728.1" /translation="MSDFSERDRELLAMFGMGEDQVRDDVERMESETAGHGITGPVHYA LHMLPEHGEEMVSMTVKLPKSQLEKVTETARRYHISRSEYVRRQLAGAV" CDS complement(2174..2464) /codon_start=1 /note="unnamed protein product; orfX-like" /protein_id="SJL86729.1" /translation="MTIQTIRKKRPLPAKELAAMYDVSVRTIQRWASQTRKDWIDEQAT LRESIRAYHDDEGHTWPQTAEHFGMSQDAVRSRCYRARKERAAEAKAARPE" CDS complement(2461..3408) /codon_start=1 /note="unnamed protein product; repB" /protein_id="SJL86730.1" /translation="MSDEYSQPTLELSRTFEGWWLPRRPLCCDDDYSQLVRRSRTDALR CKHIEANPSALVNTIVVDIDDANAKAMALWGHRGMLPNWIAENPANGHAHAGWVLTYPV PRTDMARLKPLKLLHAVTEGLRRSVDGDEGYSGLLMKNPLSDAWDSDLCREDTYDLPDL VAALEEHGDMPPKSWTRTKRAREVGVGRNCTLFDEARTLAYRQVRRLPDRTPASSDLLR EYVRRTCHEINASFPDPLPVREVNDTAKSIHKWITTRSRMWRDGAVANAATFVAIQSAR GRKGGRGNKRDKQGNVQNAFKQKAELFGKEMMGQ" primer_bind complement(4024..4040) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4048..4064) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4072..4102) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(4117..4138) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4426..5014) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5188..6045) /label="AmpR" /note="beta-lactamase" promoter complement(6046..6150) /label="AmpR promoter"
This page is informational only.