pALH122 vector (V009524)

LOCUS       V009524                12248 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V009524
VERSION     V009524
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 12248)
  AUTHORS   Honeyman AL, Cote CK, Curtiss R III.
  TITLE     Construction of transcriptional and translational lacZ gene reporter
            plasmids for use in Streptococcus mutans
  JOURNAL   J. Microbiol. Methods 49 (2), 163-171 (2002)
   PUBMED   11830302
REFERENCE   2  (bases 1 to 12248)
  AUTHORS   Honeyman AL, Cote CK, Curtiss R III.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2001) Department of Medical Microbiology and
            Immunology, University of South Florida, 12901 Bruce B. Downs Blvd.,
            Tampa, FL 33612, USA
REFERENCE   3  (bases 1 to 12248)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12248)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Microbiol. Methods"; date: "2002"; volume: "49"; issue: "2"; pages:
            "163-171"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (06-AUG-2001) Department of Medical Microbiology and Immunology,
            University of South Florida, 12901 Bruce B. Downs Blvd., Tampa, FL
            33612, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12248
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(655..3726)
                     /label="lacZ"
                     /note="beta-galactosidase"
     regulatory      complement(3735..3741)
                     /label="lacZ modified"
                     /note="lacZ modified"
                     /regulatory_class="ribosome_binding_site"
     misc_feature    complement(3741..3743)
                     /label="stop codon"
                     /note="stop codon"
     misc_feature    complement(3745..3747)
                     /label="stop codon"
                     /note="stop codon"
     misc_feature    complement(3749..3751)
                     /label="stop codon"
                     /note="stop codon"
     CDS             complement(5468..6124)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(6125..6227)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(6753..7298)
                     /direction=LEFT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     CDS             9260..9973
                     /codon_start=1
                     /gene="rep"
                     /product="replication protein"
                     /label="rep"
                     /note="derived from pVA380-1; required for Gram positive
                     hosts"
                     /protein_id="AAN02499.1"
                     /translation="MKYAYQAELVVNEAMKRYPKGRFLFLTLTIKNISGEKLNKSISEI
                     GRAFNRLMKYKKVDKNVIGYLRATEVTYSTEHENYHPHLHVLLFVKSSYFTGNNTNYIS
                     QEEWTKLWAKAMKLDYTPVVDIRTVKAHKRKNLKSAIIETAKYPVKPFDVDTEDVTLFS
                     EMVKERITEDLTNGLHRKRQIGFGKLFKKIKAELALDDVEEGNLVQTGAEESAESTGRE
                     IVAFWNWDRKNYFVR"
     gene            9260..9973
                     /gene="rep"
                     /label="rep"
     CDS             complement(10601..11335)
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"