Basic Vector Information
- Vector Name:
- pAL23
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8325 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Karim AA, Gestaut DR, Fincker M, Ruth JC, Holmes EC, Sheu W, Spormann AM.
pAL23 vector Vector Map
pAL23 vector Sequence
LOCUS 40924_4324 8325 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pAL23, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8325) AUTHORS Karim AA, Gestaut DR, Fincker M, Ruth JC, Holmes EC, Sheu W, Spormann AM. TITLE Fine-tuned Protein Production in Methanosarcina acetivorans C2A JOURNAL ACS Synth Biol (2018) In press PUBMED 29920209 REFERENCE 2 (bases 1 to 8325) AUTHORS Karim AA. TITLE Direct Submission JOURNAL Submitted (30-NOV-2017) Civil and Environmental Engineering, Stanford University, Y2E2, 473 Via Ortega, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 8325) TITLE Direct Submission REFERENCE 4 (bases 1 to 8325) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth Biol (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-NOV-2017) Civil and Environmental Engineering, Stanford University, Y2E2, 473 Via Ortega, Stanford, CA 94305, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8325 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 26..42 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 99..5569 /label=pC2A sequence /note="pC2A sequence" CDS complement(705..1649) /codon_start=1 /gene="ssrA" /product="site-specific recombinase A" /label=ssrA /protein_id="AWW92029.1" /translation="MGEMAAIQLTGIYEPLDNERLISLFTSDCIGRGYSKRTIEGYVSH AKFFLQMCGVNAGFPELEGFLVHIRDERQYTLATCNNYFASLSTFFDFLEFKHIIERNN IPTFRKRYLRSYKKYHTPETRQLITIEDMAKLVKVPRYPMYQALIIFLAKTGIRRNELI TLDRADIDLEKCTVRLKKTAKRSNRIVFFDLETKAFLEAYLNTRHDKEKALFIGRQNGH RVQRNLVYDIVTSAASSIGLHNPEGRLEEHFTPHCCRHWFTTWLRRSGMERTFIQELRG DSRGEAIDVYDHIEKDELREAYLKCIPQLGIKP" gene complement(705..1649) /gene="ssrA" /label=ssrA misc_feature 2132..2779 /label=Orf2 /note="Orf2" misc_feature complement(2785..3213) /label=Orf1 /note="Orf1" CDS complement(3292..4902) /codon_start=1 /gene="repA" /product="regulatory protein RepA" /label=repA /protein_id="AWW92030.1" /translation="MSSDFSSRPGAVSYAPECRDFATCICTDGVLCPVRNKKNGVSICK YYSCPDFDFSKCSKYRPLKVGDFVLPAKGKRPAYCGRPFTYAVSENYNARKDLNSHCNT LSCPGCGILSELQHRFALVVILWTYALFSGQFPSWGFASMDFSRGVSVEAIRLFRRNLK DRLERWGVTAGTTIFHPYRIKPEITRAIRKLTGLKGNDDSEAFWNYIRDDHNEGNLNKI ADLLNIEINSIYDCLILAPHFHFFIFPGNIRITGKNPKSKKRCKSDEYDIFIQRLSHKV NGKRQWELRSLMDIYKQVTYLYSHVGQLTDNRYGNIHIESRFGALFRWHPDKVVSSSGK LTFEQLIDTRTEVLNLINEGREVKLVYNGELKWEGQENDDTGWIPLTKLRDHFSGGRQA LHAYLKEAKAVKPEYADYLQQLIARNNFYHNLKGRDGKNKVPKKWRKLWASPFKVDELP EFLKLEPAGSLLRVWFLEGLPDPPAGFLVVDSHQWEHDGCIIEESPEMPSNSLQKASEI NYEELFTSLKSRSMMFGGD" gene complement(3292..4902) /gene="repA" /label=repA regulatory 5566..5927 /label=mcr promoter from Methanococcus voltae /note="mcr promoter from Methanococcus voltae" /regulatory_class="promoter" CDS 5928..6524 /label=PuroR /note="puromycin N-acetyltransferase" regulatory 6528..6867 /label=mcr terminator from Methanococcus voltae /note="mcr terminator from Methanococcus voltae" /regulatory_class="terminator" rep_origin complement(6885..7273) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory complement(7302..7334) /label=bla terminator /note="bla terminator" /regulatory_class="terminator" CDS complement(7338..8195) /label=AmpR /note="beta-lactamase" promoter complement(8196..8300) /label=AmpR promoter
This page is informational only.