Basic Vector Information
- Vector Name:
- pAJM.969
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4558 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Meyer AJ, Segall-Shapiro TH, Voigt CA.
pAJM.969 vector Map
pAJM.969 vector Sequence
LOCUS V009539 4558 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009539 VERSION V009539 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4558) AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA. TITLE Marionette: E. coli containing 12 highly-optimized small molecule sensors JOURNAL bioRxivorg 285866, 1-26 (2018) REFERENCE 2 (bases 1 to 4558) AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA. TITLE Direct Submission JOURNAL Submitted (21-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 4558) TITLE Direct Submission REFERENCE 4 (bases 1 to 4558) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg 285866, 1-26 (2018)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4558 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..53 /label="L3S3P21" /note="L3S3P21" /regulatory_class="terminator" regulatory 73..124 /label="PMph" /note="PMph" /regulatory_class="promoter" misc_feature 74..108 /label="MphO operator" /note="MphO operator" regulatory 76..81 /regulatory_class="minus_35_signal" regulatory 99..104 /regulatory_class="minus_10_signal" regulatory 111 /label="+1" /note="+1" /regulatory_class="other" misc_RNA 126..176 /label="sTRSV HHRz" /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 208..219 /label="B0064" /note="B0064" /regulatory_class="ribosome_binding_site" CDS 226..942 /label="EYFP" /note="enhanced YFP" regulatory 946..1006 /label="L3S2P21" /note="L3S2P21" /regulatory_class="terminator" regulatory 1011..1064 /label="PLacIQ" /note="PLacIQ" /regulatory_class="promoter" regulatory 1029..1034 /regulatory_class="minus_35_signal" regulatory 1052..1057 /regulatory_class="minus_10_signal" regulatory 1065..1092 /label="mph2" /note="mph2" /regulatory_class="ribosome_binding_site" CDS 1093..1677 /codon_start=1 /product="MphR-AM" /label="MphR-AM" /protein_id="AYJ72267.1" /translation="MPRPKLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALI QRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMDTRNDFSVNYL ISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDG ELADHVLAQIAAILCLMFPEHDDFQLLQAHA" regulatory 1678..1698 /label="ery1" /note="ery1" /regulatory_class="ribosome_binding_site" CDS 1699..2430 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" regulatory 2443..2697 /label="induction operon terminator region" /note="induction operon terminator region" /regulatory_class="terminator" rep_origin complement(3009..3554) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3646..4458) /label="KanR" /note="aminoglycoside phosphotransferase"
This page is informational only.