Basic Vector Information
- Vector Name:
- pAJM.773
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3951 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Meyer AJ, Segall-Shapiro TH, Voigt CA.
pAJM.773 vector Vector Map
pAJM.773 vector Sequence
LOCUS 40924_4244 3951 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pAJM.773, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3951) AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA. TITLE Marionette: E. coli containing 12 highly-optimized small molecule sensors JOURNAL bioRxivorg 285866, 1-26 (2018) REFERENCE 2 (bases 1 to 3951) AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA. TITLE Direct Submission JOURNAL Submitted (21-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 3951) TITLE Direct Submission REFERENCE 4 (bases 1 to 3951) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg 285866, 1-26 (2018)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-MAR-2018) Synthetic Biology Center, Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3951 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..53 /label=L3S3P21 /note="L3S3P21" /regulatory_class="terminator" regulatory 73..122 /label=PVanCC /note="PVanCC" /regulatory_class="promoter" misc_feature 73..84 /label=VanO operator /note="VanO operator" regulatory 84..89 /regulatory_class="minus_35_signal" regulatory 107..112 /regulatory_class="minus_10_signal" misc_feature 111..122 /label=VanO operator /note="VanO operator" regulatory 119 /label=+1 /note="+1" /regulatory_class="other" misc_RNA 124..174 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 206..217 /label=B0064 /note="B0064" /regulatory_class="ribosome_binding_site" CDS 224..940 /label=EYFP /note="enhanced YFP" regulatory 944..1004 /label=L3S2P21 /note="L3S2P21" /regulatory_class="terminator" regulatory 1009..1062 /label=PLacIQ /note="PLacIQ" /regulatory_class="promoter" regulatory 1027..1032 /regulatory_class="minus_35_signal" regulatory 1050..1055 /regulatory_class="minus_10_signal" regulatory 1063..1091 /label=van2 /note="van2" /regulatory_class="ribosome_binding_site" CDS 1092..1826 /codon_start=1 /product="VanR-AM" /label=VanR-AM /protein_id="AYJ72236.1" /translation="MDMPRIKPGQRVMMALRKMIASGEIKSGERIAEIPTAAALGVSRM PVRIALRSLEQEGLVVRLGARGYAARGVSSDQIRDAIEVRGVLEGFAARRLAERGMTAE THARFVVLIAEGEALFAAGRLNGEDLDRYAAYNQAFHDTLVSAAGNGAVESALARNGFE PFAAAGALALDLMDLSAEYEHLLAAHRQHQAVLDAVSCGDAEGAERIMRDHALAAIRNA KVFEAAASAGAPLGAAWSIRAD" regulatory 1836..2090 /label=induction operon terminator region /note="induction operon terminator region" /regulatory_class="terminator" rep_origin complement(2402..2947) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3039..3851) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.