pAJM.1642 vector (V009553)

Basic Vector Information

Vector Name:
pAJM.1642
Antibiotic Resistance:
Kanamycin
Length:
4143 bp
Type:
Cloning vector
Replication origin:
p15A ori
Source/Author:
Meyer AJ, Segall-Shapiro TH, Voigt CA.

pAJM.1642 vector Map

pAJM.16424143 bp60012001800240030003600L3S3P21PCinsTRSV HHRzB0064EYFPL3S2P21PLacIcin1CinR-AMinduction operon terminator regionp15A oriKanR

pAJM.1642 vector Sequence

LOCUS       40924_4194        4143 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pAJM.1642, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4143)
  AUTHORS   Meyer AJ, Segall-Shapiro TH, Voigt CA.
  TITLE     Marionette: E. coli containing 12 highly-optimized small molecule 
            sensors
  JOURNAL   bioRxivorg 285866, 1-26 (2018)
REFERENCE   2  (bases 1 to 4143)
  AUTHORS   Meyer AJ, Segall-Shapiro TH, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2018) Synthetic Biology Center, Department of 
            Biological Engineering, Massachusetts Institute of Technology, 77 
            Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 4143)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4143)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg 
            285866, 1-26 (2018)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-MAR-2018) Synthetic Biology Center, Department of Biological 
            Engineering, Massachusetts Institute of Technology, 77 Massachusetts
            Avenue, Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4143
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      1..53
                     /label=L3S3P21
                     /note="L3S3P21"
                     /regulatory_class="terminator"
     regulatory      73..298
                     /label=PCin
                     /note="PCin"
                     /regulatory_class="promoter"
     misc_feature    225..245
                     /label=CinO operator
                     /note="CinO operator"
     regulatory      246..251
                     /regulatory_class="minus_35_signal"
     regulatory      269..274
                     /regulatory_class="minus_10_signal"
     misc_RNA        300..350
                     /label=sTRSV HHRz
                     /note="hammerhead ribozyme from the tobacco ringspot virus 
                     satellite RNA (Khvorova et al., 2003)"
     regulatory      382..393
                     /label=B0064
                     /note="B0064"
                     /regulatory_class="ribosome_binding_site"
     CDS             400..1116
                     /label=EYFP
                     /note="enhanced YFP"
     regulatory      1120..1180
                     /label=L3S2P21
                     /note="L3S2P21"
                     /regulatory_class="terminator"
     regulatory      1185..1238
                     /label=PLacI
                     /note="PLacI"
                     /regulatory_class="promoter"
     regulatory      1203..1208
                     /regulatory_class="minus_35_signal"
     regulatory      1226..1231
                     /regulatory_class="minus_10_signal"
     regulatory      1239..1266
                     /label=cin1
                     /note="cin1"
                     /regulatory_class="ribosome_binding_site"
     CDS             1267..2022
                     /codon_start=1
                     /product="CinR-AM"
                     /label=CinR-AM
                     /protein_id="AYJ72261.1"
                     /translation="MIENTYSEKFESAFEQIKAAANVDAAIRILQAEYNLDFVTYHLAQ
                     TIASKIDSPFVRTTYPDAWVSRYLLNCYVKVDPIIKQGFERQLPFDWSEVEPTPEAYAM
                     LVDAQKHGIDDNGYSIPVADKAQRRALLSLNAHIPADEWTELVRRCRNEWIEIAHLIHR
                     KAVYELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFRLG
                     CTTISAAASRAVQLRIINPYRIRMTRRNW"
     regulatory      2028..2282
                     /label=induction operon terminator region
                     /note="induction operon terminator region"
                     /regulatory_class="terminator"
     rep_origin      complement(2594..3139)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(3231..4043)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"

This page is informational only.