pAIL2 vector (V009559)

LOCUS       40924_4169        4504 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Bacterial expression vector pAIL2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4504)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4504)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 4504)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4504)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4504
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      27..75
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     regulatory      134..215
                     /label=fd terminator
                     /note="fd terminator"
                     /regulatory_class="terminator"
     terminator      137..185
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     rep_origin      313..768
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     rep_origin      complement(927..1515)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1689..2546)
                     /label=AmpR
                     /note="beta-lactamase"
     CDS             complement(2864..3520)
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(3521..3623)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     promoter        3788..3816
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    3824..3840
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    3865..3881
                     /label=5' UTR of ompA, incl. RBS
                     /note="5' UTR of ompA, incl. RBS"
     sig_peptide     3882..3944
                     /label=OmpA signal peptide
                     /note="signal peptide from the E. coli outer membrane
                     protein OmpA"
     CDS             3945..4394
                     /codon_start=1
                     /note="unnamed protein product; mIL2 mature sequence"
                     /protein_id="SJL88453.1"
                     /translation="APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENY
                     RNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNI
                     RVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ"
     misc_feature    4395..4497
                     /label=3' UTR of mIL2
                     /note="3' UTR of mIL2"