Basic Vector Information
- Vector Name:
- pAGW570
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9773 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Source/Author:
- Biswal AK, Atmodjo MA, Pattathil S, Amos RA, Yang X, Winkeler K, Collins C, Mohanty SS, Ryno D, Tan L, Gelineo-Albersheim I, Hunt K, Sykes RW, Turner GB, Ziebell A, Davis MF, Decker SR, Hahn MG, Mohne
pAGW570 vector Map
pAGW570 vector Sequence
LOCUS 40924_4135 9773 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pAGW570, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9773) AUTHORS Biswal AK, Atmodjo MA, Pattathil S, Amos RA, Yang X, Winkeler K, Collins C, Mohanty SS, Ryno D, Tan L, Gelineo-Albersheim I, Hunt K, Sykes RW, Turner GB, Ziebell A, Davis MF, Decker SR, Hahn MG, Mohnen D. TITLE Increased xylan production by overexpression of GalactUronosylTransferase12 (GAUT12) results in increased recalcitrance and decreased growth in Populus woody biofuel feedstock JOURNAL Unpublished REFERENCE 2 (bases 1 to 9773) AUTHORS Rottmann W, Winkeler K, Biswal AK, Yang X. TITLE Direct Submission JOURNAL Submitted (26-JUN-2017) Biochemistry and Molecular Biology; Complex Carbohydrate Research Center, The University of Georgia, 315 Riverbend Rd, Athens, GA 30602, USA REFERENCE 3 (bases 1 to 9773) TITLE Direct Submission REFERENCE 4 (bases 1 to 9773) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-JUN-2017) Biochemistry and Molecular Biology; Complex Carbohydrate Research Center, The University of Georgia, 315 Riverbend Rd, Athens, GA 30602, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..9773 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 104..634 /label=oriV /note="incP origin of replication" CDS 907..1698 /label=KanR /note="aminoglycoside phosphotransferase" CDS 2000..3145 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" misc_feature 3505..3529 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" primer_bind 3867..3883 /label=SK primer /note="common sequencing primer, one of multiple similar variants" regulatory complement(3885..4105) /label=nopaline synthase (nos) terminator /note="nopaline synthase (nos) terminator" /regulatory_class="terminator" terminator 3896..4148 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(4154..4945) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory complement(4946..6272) /note="Arabidopsis thaliana UBIQUITIN10 (At4g05320) promoter plus 5'-UTR" /regulatory_class="promoter" terminator complement(6310..6562) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" protein_bind 6597..6621 /label=attB2 /note="recombination site for the Gateway(R) BP reaction" CDS complement(6646..8247) /codon_start=1 /product="galacturonosyltransferase 12" /label=galacturonosyltransferase 12 /note="PtGAUT12.1 (Potri.001G416800); GAUT12" /protein_id="AUG68175.1" /translation="MQLHISPSLRHVTVFPGKGVREFIKVRVGARRVSYRMLFYSLLFF TFLLRFVFVLSTVDSIDGETKCSTLGCLGKRLGPRILGRRLDSAVPEVMFQVLEQPLGN DELKGRSDIPQTLEEFMDEVKNTRLDAKTFALKLREMVTLLEQRTRNAKIQEYLYRHVA SSSIPKQLHCLALRLASEHSTNAAARLQLPLPELVPALVDNTYFHFVLASDNVLAAAVV ANSLVQNALRPQKFVLHIITDRKTYSPMQAWFSLHPLAPAIIEVKALHHFDWFAKGKVP VMEAMEKDQRVRSQFRGGSSAIVANNTEKPHIIAAKLQTLSPKYNSVMNHIRIHLPELF PSLNKVVFLDDDIVVQSDLSPLWDIDMNGKVNGAVETCRGEDKFVMSKKLKSYLNFSHP LISENFKPNECAWAYGMNIFDLEAWRKTNISTTYHHWVEENLKSDLSLWQLGTLPPGLI AFHGHVHVIDPFWHMLGLGYQENTSLADAETAGVIHFNGRAKPWLDIAFPQLRPLWAKY INFSDKFIKGCHIRPS" protein_bind complement(8274..8298) /label=attB1 /note="recombination site for the Gateway(R) BP reaction" regulatory complement(8320..9672) /note="Arabidopsis thaliana UBIQUITIN3 (At5g03240) promoter (- intron)" /regulatory_class="promoter" primer_bind complement(9676..9692) /label=KS primer /note="common sequencing primer, one of multiple similar variants" misc_feature 9745..9769 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.