Basic Vector Information
- Vector Name:
- pAGRIKOLA
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10459 bp
- Type:
- Cloning vector
- Replication origin:
- pSa ori
- Host:
- Plants
- Source/Author:
- Hilson P, Allemeersch J, Altmann T, Aubourg S, Avon A, Beynon J, Bhalerao RP, Bitton F, Caboche M, Cannoot B, Chardakov V, Cognet-Holliger C, Colot V, Crowe M, Darimont C, Durinck S, Eickhoff H, de Lo
- Promoter:
- CaMV 35S
pAGRIKOLA vector Vector Map
pAGRIKOLA vector Sequence
LOCUS 40924_4125 10459 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pAGRIKOLA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10459) AUTHORS Hilson P, Allemeersch J, Altmann T, Aubourg S, Avon A, Beynon J, Bhalerao RP, Bitton F, Caboche M, Cannoot B, Chardakov V, Cognet-Holliger C, Colot V, Crowe M, Darimont C, Durinck S, Eickhoff H, de Longevialle AF, Farmer EE, Grant M, Kuiper MT, Lehrach H, Leon C, Leyva A, Lundeberg J, Lurin C, Moreau Y, Nietfeld W, Paz-Ares J, Reymond P, Rouze P, Sandberg G, Segura MD, Serizet C, Tabrett A, Taconnat L, Thareau V, Van Hummelen P, Vercruysse S, Vuylsteke M, Weingartner M, Weisbeek PJ, Wirta V, Wittink FR, Zabeau M, Small I. TITLE Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications JOURNAL Genome Res. 14 (10B), 2176-2189 (2004) PUBMED 15489341 REFERENCE 2 (bases 1 to 10459) AUTHORS Small ID, Hilson P. TITLE pAGRIKOLA sequence JOURNAL Unpublished REFERENCE 3 (bases 1 to 10459) AUTHORS Small ID, Hilson P. TITLE Direct Submission JOURNAL Submitted (07-MAR-2004) URGV, INRA/CNRS/UEVE, 2, rue Gaston Cremieux, CP5708, Evry, Essonne 91057, France REFERENCE 4 (bases 1 to 10459) TITLE Direct Submission REFERENCE 5 (bases 1 to 10459) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res. 14 (10B), 2176-2189 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (07-MAR-2004) URGV, INRA/CNRS/UEVE, 2, rue Gaston Cremieux, CP5708, Evry, Essonne 91057, France" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..10459 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 18..672 /label=colE1 /note="colE1" rep_origin complement(61..649) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(823..1635) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1926..2361 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 2488..2510 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" terminator complement(2534..2786) /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" CDS complement(2809..3357) /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" promoter complement(3399..3578) /label=NOS promoter /note="nopaline synthase promoter" primer_bind 3825..3841 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3851..3869 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 3895..3911 /label=KS primer /note="common sequencing primer, one of multiple similar variants" primer_bind complement(3945..3961) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter 4968..5313 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" protein_bind 5322..5446 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" CDS complement(5878..6180) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(6619..6743) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" intron 6770..7538 /label=PDK intron /note="pyruvate orthophosphate dikinase intron from Flaveria trinervia" intron complement(7573..7762) /label=cat1 intron /note="castor bean catalase intron, modified" protein_bind 7786..7910 /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS complement(8242..8544) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(9075..9199) /label=attR1 /note="recombination site for the Gateway(R) LR reaction" terminator 9208..9915 /label=OCS terminator /note="octopine synthase terminator" promoter complement(9956..9974) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter complement(10013..10031) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(10052..10068) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 10076..10092 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(10100..10130) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(10145..10166) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." misc_feature 10405..10429 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.