pAGRIKOLA vector (V009567)

Download GeneBank File(.gb)

LOCUS       40924_4125       10459 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pAGRIKOLA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10459)
  AUTHORS   Hilson P, Allemeersch J, Altmann T, Aubourg S, Avon A, Beynon J, 
            Bhalerao RP, Bitton F, Caboche M, Cannoot B, Chardakov V, 
            Cognet-Holliger C, Colot V, Crowe M, Darimont C, Durinck S, Eickhoff
            H, de Longevialle AF, Farmer EE, Grant M, Kuiper MT, Lehrach H, Leon
            C, Leyva A, Lundeberg J, Lurin C, Moreau Y, Nietfeld W, Paz-Ares J, 
            Reymond P, Rouze P, Sandberg G, Segura MD, Serizet C, Tabrett A, 
            Taconnat L, Thareau V, Van Hummelen P, Vercruysse S, Vuylsteke M, 
            Weingartner M, Weisbeek PJ, Wirta V, Wittink FR, Zabeau M, Small I.
  TITLE     Versatile gene-specific sequence tags for Arabidopsis functional 
            genomics: transcript profiling and reverse genetics applications
  JOURNAL   Genome Res. 14 (10B), 2176-2189 (2004)
  PUBMED    15489341
REFERENCE   2  (bases 1 to 10459)
  AUTHORS   Small ID, Hilson P.
  TITLE     pAGRIKOLA sequence
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 10459)
  AUTHORS   Small ID, Hilson P.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAR-2004) URGV, INRA/CNRS/UEVE, 2, rue Gaston 
            Cremieux, CP5708, Evry, Essonne 91057, France
REFERENCE   4  (bases 1 to 10459)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 10459)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genome Res.
            14 (10B), 2176-2189 (2004)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (07-MAR-2004) URGV, INRA/CNRS/UEVE, 2, rue Gaston Cremieux, CP5708, 
            Evry, Essonne 91057, France"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10459
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      18..672
                     /label=colE1
                     /note="colE1"
     rep_origin      complement(61..649)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(823..1635)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      1926..2361
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"
     misc_feature    2488..2510
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA
                     (truncated)"
     terminator      complement(2534..2786)
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     CDS             complement(2809..3357)
                     /codon_start=1
                     /label=BlpR
                     /note="phosphinothricin acetyltransferase"
                     /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE
                     WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS
                     TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF
                     WQLDFSLPVPPRPVLPVTEI"
     promoter        complement(3399..3578)
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     primer_bind     3825..3841
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        3851..3869
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     3895..3911
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(3945..3961)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        4968..5313
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     protein_bind    5322..5446
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             complement(5878..6180)
                     /codon_start=1
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     protein_bind    complement(6619..6743)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     intron          6770..7538
                     /label=PDK intron
                     /note="pyruvate orthophosphate dikinase intron from
                     Flaveria trinervia"
     intron          complement(7573..7762)
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     protein_bind    7786..7910
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             complement(8242..8544)
                     /codon_start=1
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     protein_bind    complement(9075..9199)
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     terminator      9208..9915
                     /label=OCS terminator
                     /note="octopine synthase terminator"
     promoter        complement(9956..9974)
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     promoter        complement(10013..10031)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(10052..10068)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    10076..10092
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(10100..10130)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(10145..10166)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     misc_feature    10405..10429
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"