Basic Vector Information
- Vector Name:
- pADH77
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8250 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nobile CJ.
pADH77 vector Map
pADH77 vector Sequence
LOCUS 40924_4065 8250 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pADH77, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8250) AUTHORS Nobile CJ. TITLE The Transcriptional Circuitry Controlling Candida albicans Biofilm Formation JOURNAL Unpublished REFERENCE 2 (bases 1 to 8250) AUTHORS Hernday AD. TITLE Direct Submission JOURNAL Submitted (27-SEP-2011) Biochemistry and Biophysics, UCSF, Genentech Hall N374, 600 16th Street, San Francisco, CA 94143, USA REFERENCE 3 (bases 1 to 8250) TITLE Direct Submission REFERENCE 4 (bases 1 to 8250) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-SEP-2011) Biochemistry and Biophysics, UCSF, Genentech Hall N374, 600 16th Street, San Francisco, CA 94143, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8250 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 35..742 /codon_start=1 /label=mCherry /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA EGRHSTGGMDELYK" protein_bind complement(752..785) /label=FRT (minimal) /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" CDS 1344..2612 /codon_start=1 /label=FLP /note="site-specific recombinase" /translation="MPQFDILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMI THNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTI IPYYGQKHQSDITDIVSSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILN SFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTET KTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVR SYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVAR TTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIR YPAWNGIISQEVLDYLSSYINRRI" protein_bind complement(4872..4905) /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" primer_bind complement(4907..4923) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(4960..4978) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4999..5015) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5023..5039) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5047..5077) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5092..5113) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5401..5989) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 6209..6311 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 6312..6968 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(7459..7564) /label=AmpR promoter rep_origin 7591..8046 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 8187..8203 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 8213..8231 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.