Basic Vector Information
- Vector Name:
- pcDNA3flag-Tax1BP1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7613 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pcDNA3flag-Tax1BP1 vector Map
pcDNA3flag-Tax1BP1 vector Sequence
LOCUS 40924_10186 7613 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pcDNA3flag-Tax1BP1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7613) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 7613) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 7613) TITLE Direct Submission REFERENCE 4 (bases 1 to 7613) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7613 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 235..614 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 615..818 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 863..881 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 922..945 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 967..3210 /codon_start=1 /note="unnamed protein product; hTAX1BP1" /protein_id="SJL87427.1" /translation="MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPH PKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCY VTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEE LLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKK RFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKE LYKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFL LTTSSKEDTCFLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENE KVKKQLADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQR LQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFD IVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENV KLELAEVQDNYKELKRSLENPAERKMEDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQ PARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELM FPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD" promoter complement(3238..3256) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" polyA_signal 3282..3506 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 3552..3980 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4033..4243 /label=SV40 promoter /note="SV40 early promoter" CDS 4318..5109 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 5286..5419 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(5456..5472) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5480..5496) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5504..5534) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5549..5570) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5858..6446) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6620..7477) /label=AmpR /note="beta-lactamase" promoter complement(7478..7582) /label=AmpR promoter
This page is informational only.