pcDNA3-AQP4f vector (V008599)

LOCUS       40924_9926        6510 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector pcDNA3-AQP4f, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6510)
  AUTHORS   Moe SE, Sorbo JG, Sogaard R, Zeuthen T, Petter Ottersen O, Holen T.
  TITLE     New isoforms of rat Aquaporin-4
  JOURNAL   Genomics 91 (4), 367-377 (2008)
  PUBMED    18255256
REFERENCE   2  (bases 1 to 6510)
  AUTHORS   Sorbo JG, Moe SE, Holen TV.
  TITLE     New Isoforms of Rat Aquaporin-4
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 6510)
  AUTHORS   Sorbo JG, Moe SE, Holen TV.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2007) CMBN, University of Oslo, Sognsvannsveien 9,
            Oslo, no 0317, Norway
REFERENCE   4  (bases 1 to 6510)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 6510)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genomics"; 
            date: "2008"; volume: "91"; issue: "4"; pages: "367-377"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (12-FEB-2007) CMBN, University of Oslo, Sognsvannsveien 9, Oslo, no 
            0317, Norway"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6510
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        235..614
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        615..818
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        863..881
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1021..1950
                     /codon_start=1
                     /product="AQP4f"
                     /label=AQP4f
                     /note="aquaporin-4 isoform; derived from Rattus norvegicus 
                     strain PVG"
                     /protein_id="ABO09759.1"
                     /translation="MVQNLSTPTLQKPNQTSARNLIPEHWSLGAGNESCTPAREGMSDG
                     AAARRWGKCGPPCSRESIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWGGSE
                     NPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYITAQ
                     CLGAIIGAGILYLVTPPSVVGGLGVTTINYTGASMNPARSFGPAVIMGNWENHWIYWVG
                     PIIGAVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILK
                     PGVVHVIDIDRGDEKKGKDSSGEVLSSV"
     regulatory      1387..1396
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     promoter        complement(2062..2080)
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     polyA_signal    2106..2330
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      2376..2804
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2818..3148
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     CDS             3215..4006
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     polyA_signal    4183..4316
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(4353..4369)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4377..4393)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4401..4431)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4446..4467)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(4755..5343)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5517..6374)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(6375..6479)
                     /label=AmpR promoter