Basic Vector Information
- Vector Name:
- pCDF-RpALS
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4955 bp
- Type:
- Cloning vector
- Replication origin:
- CloDF13 ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
pCDF-RpALS vector Vector Map
pCDF-RpALS vector Sequence
LOCUS 40924_9421 4955 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCDF-RpALS, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4955) AUTHORS Kim B, Binkley R, Kim HU, Lee SY. TITLE Metabolic engineering of Escherichia coli for the enhanced production of l-tyrosine JOURNAL Biotechnol. Bioeng. (2018) In press PUBMED 30019750 REFERENCE 2 (bases 1 to 4955) AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY. TITLE Direct Submission JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea REFERENCE 3 (bases 1 to 4955) TITLE Direct Submission REFERENCE 4 (bases 1 to 4955) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng. (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4955 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 3..27 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 42..64 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 71..1246 /codon_start=1 /gene="ALS" /product="aloesone synthase" /label=ALS /note="derived from Rheum palmatum" /protein_id="AXN70001.1" /translation="MADVLQEIRNSQKASGPATVLAIGTAHPPTCYPQADYPDFYFRVC KSEHMTKLKKKMQFICDRSGIRQRFMFHTEENLGKNPGMCTFDGPSLNARQDMLIMEVP KLGAEAAEKAIKEWGQDKSRITHLIFCTTTSNDMPGADYQFATLFGLNPGVSRTMVYQQ GCFAGGTVLRLVKDIAENNKGARVLVVCSEIVAFAFRGPHEDHIDSLIGQLLFGDGAAA LVVGTDIDESVERPIFQIMSATQATIPNSLHTMALHLTEAGLTFHLSKEVPKVVSDNME ELMLEAFKPLGITDWNSIFWQVHPGGRAILDKIEEKLELTKDKMRDSRYILSEYGNLTS ACVLFVMDEMRKRSFREGKQTTGDGYEWGVAIGLGPGLTVETVVLRSVPIP" gene 71..1246 /gene="ALS" /label=ALS CDS 1257..1274 /label=6xHis /note="6xHis affinity tag" promoter 1388..1406 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1407..1431 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1540..1584 /label=S-Tag /note="affinity and epitope tag derived from pancreatic ribonuclease A" terminator 1636..1683 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(1857..2645) /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" promoter complement(2646..2737) /label=AmpR promoter rep_origin complement(2785..3523) /direction=LEFT /label=CloDF13 ori /note="Plasmids containing the CloDF13 (CDF) origin of replication can be propagated in E. coli cells that contain additional plasmids with compatible origins." protein_bind complement(3699..3720) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3736..4815) /label=lacI /note="lac repressor" promoter complement(4816..4893) /label=lacI promoter regulatory 4939..4955 /label=T7 promoter /note="T7 promoter" /regulatory_class="promoter"
This page is informational only.