Basic Vector Information
- Vector Name:
- pCDF-BIRA
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4482 bp
- Type:
- Co-expression vector
- Replication origin:
- CloDF13 ori
- Source/Author:
- Keates T, Cooper CD, Savitsky P, Allerston CK, Phillips C, Hammarstrom M, Daga N, Berridge G, Mahajan P, Burgess-Brown NA, Muller S, Graslund S, Gileadi O.
pCDF-BIRA vector Vector Map
pCDF-BIRA vector Sequence
LOCUS 40924_9391 4482 bp DNA circular SYN 17-DEC-2018 DEFINITION Co-expression vector pCDF-BIRA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4482) AUTHORS Keates T, Cooper CD, Savitsky P, Allerston CK, Phillips C, Hammarstrom M, Daga N, Berridge G, Mahajan P, Burgess-Brown NA, Muller S, Graslund S, Gileadi O. TITLE Expressing the human proteome for affinity proteomics: optimising expression of soluble protein domains and in vivo biotinylation JOURNAL N Biotechnol 29 (5), 515-525 (2012) PUBMED 22027370 REFERENCE 2 (bases 1 to 4482) AUTHORS Savitsky P, Gileadi O. TITLE Direct Submission JOURNAL Submitted (04-MAY-2011) Structural Genomics Consortium, University of Oxford, Old Road Campus Research Building, Roosevelt Drive, Oxford, Oxfordshire OX3 7DQ, UK REFERENCE 3 (bases 1 to 4482) TITLE Direct Submission REFERENCE 4 (bases 1 to 4482) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "N Biotechnol"; date: "2012"; volume: "29"; issue: "5"; pages: "515-525" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-MAY-2011) Structural Genomics Consortium, University of Oxford, Old Road Campus Research Building, Roosevelt Drive, Oxford, Oxfordshire OX3 7DQ, UK" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4482 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 84..102 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 103..127 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 142..164 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 174..1136 /codon_start=1 /label=BirA /note="E. coli biotin protein ligase" /translation="VKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRD WGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSG DACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRK LGADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQG WITLQEAGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIG DKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLRSAEK" CDS 1167..1211 /codon_start=1 /label=S-Tag /note="affinity and epitope tag derived from pancreatic ribonuclease A" /translation="KETAAAKFERQHMDS" terminator 1263..1310 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(1484..2272) /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" promoter complement(2273..2364) /label=AmpR promoter rep_origin complement(2412..3150) /direction=LEFT /label=CloDF13 ori /note="Plasmids containing the CloDF13 (CDF) origin of replication can be propagated in E. coli cells that contain additional plasmids with compatible origins." protein_bind complement(3326..3347) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3363..4442) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(join(4443..4482,1..38)) /label=lacI promoter
This page is informational only.