Basic Vector Information
- Vector Name:
- pCD13SK-Flp-oriT
- Antibiotic Resistance:
- Streptomycin
- Length:
- 7720 bp
- Type:
- Triparental mating vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Son MS, Nguyen DT, Kang Y, Hoang TT.
- Promoter:
- T3
pCD13SK-Flp-oriT vector Map
pCD13SK-Flp-oriT vector Sequence
LOCUS 40924_9361 7720 bp DNA circular SYN 17-DEC-2018 DEFINITION Triparental mating vector pCD13SK-Flp-oriT, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7720) AUTHORS Son MS, Nguyen DT, Kang Y, Hoang TT. TITLE Engineering of FRT-lacZ fusion constructs: induction of the Pseudomonas aeruginosa fadAB1 operon by medium and long chain-length fatty acids JOURNAL Plasmid 59 (2), 111-118 (2008) PUBMED 18221997 REFERENCE 2 (bases 1 to 7720) AUTHORS Son MS, Kang Y, Nguyen DT, Hoang TT. TITLE Direct Submission JOURNAL Submitted (16-JUL-2007) Microbiology, University of Hawaii Manoa, 2538 McCarthy Mall, Honolulu, HI 96822, USA REFERENCE 3 (bases 1 to 7720) TITLE Direct Submission REFERENCE 4 (bases 1 to 7720) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2008"; volume: "59"; issue: "2"; pages: "111-118" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-JUL-2007) Microbiology, University of Hawaii Manoa, 2538 McCarthy Mall, Honolulu, HI 96822, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7720 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 25..385 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" protein_bind complement(678..909) /label=lambda attP /note="integrase from phage lambda" CDS complement(1801..2589) /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin complement(3413..3841) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 3985..4001 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4011..4029 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 4055..4071 /label=KS primer /note="common sequencing primer, one of multiple similar variants" oriT 4636..4744 /label=oriT /note="incP origin of transfer" CDS complement(4961..6229) /codon_start=1 /label=FLP /note="site-specific recombinase" /translation="MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMI THNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTI IPYYGQKHQSDITDIVSSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILN SFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTET KTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVR SYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVAR TTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIR YPAWNGIISQEVLDYLSSYINRRI" RBS 6233..6241 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 6330..7040 /codon_start=1 /label=lambda repressor (ts) /note="temperature-sensitive variant of the phage lambda repressor" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLTKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPKLRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG" promoter complement(7329..7347) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(7368..7384) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7392..7408) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7416..7446) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7461..7482) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 7720 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.