pCD-F-HLH-MK-bioC vector (V008650)

Basic Vector Information

Vector Name:
pCD-F-HLH-MK-bioC
Antibiotic Resistance:
Ampicillin
Length:
8447 bp
Type:
Mammalian expression vector
Replication origin:
ori
Source/Author:
De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.

pCD-F-HLH-MK-bioC vector Vector Map

pCD-F-HLH-MK-bioC8447 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400CMV enhancerCMV promoterT7 promoterFLAGvertebrate consensus sequence for strong initiation of translation (Kozak, 1987)Mucosa-associated lymphoid tissue lymphoma translocation protein 1SGSSGSSG linkerAviTag(TM)bGH poly(A) signalf1 oriSV40 promoterNeoR/KanRSV40 poly(A) signalM13 revlac operatorlac promoterCAP binding siteoriAmpRAmpR promoter

pCD-F-HLH-MK-bioC vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V008650                 8447 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008650
VERSION     V008650
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8447)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8447)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 8447)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8447)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
            9052, BELGIUM"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8447
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        235..614
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        615..818
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        863..881
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             923..946
                     /label="FLAG"
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     regulatory      962..971
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             968..1447
                     /codon_start=1
                     /note="unnamed protein product; HLH dimerization domain"
                     /protein_id="SJL87022.1"
                     /translation="MALLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSYAS
                     STPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFE
                     MNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQP"
     misc_feature    971..973
                     /label="Kozak"
                     /note="Kozak"
     CDS             1463..3934
                     /gene="MALT1"
                     /label="Mucosa-associated lymphoid tissue lymphoma
                     translocation protein 1"
                     /note="Mucosa-associated lymphoid tissue lymphoma
                     translocation protein 1 from Homo sapiens. Accession#:
                     Q9UDY8"
     misc_feature    3941..3964
                     /label="SGSSGSSG linker"
                     /note="SGSSGSSG linker"
     CDS             3965..4009
                     /label="AviTag(TM)"
                     /note="peptide tag that allows for enzymatic biotinylation"
     polyA_signal    4044..4268
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      4314..4742
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4756..5085
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             5152..5943
                     /label="NeoR/KanR"
                     /note="aminoglycoside phosphotransferase"
     polyA_signal    6120..6253
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(6290..6306)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6314..6330)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6338..6368)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6383..6404)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(6692..7280)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(7454..8311)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8312..8416)
                     /label="AmpR promoter"

This page is informational only.