Basic Vector Information
- Vector Name:
- pCCB9
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7225 bp
- Type:
- Plasmid vector
- Replication origin:
- ori
- Source/Author:
- Fernandez-Nino MA, Arevalo-Ferro C, Dreyer I.
pCCB9 vector Map
pCCB9 vector Sequence
LOCUS V008672 7225 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V008672
VERSION V008672
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 7225)
AUTHORS Fernandez-Nino MA, Arevalo-Ferro C, Dreyer I.
TITLE A synthetic multi-cellular network of coupled oscillators
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7225)
AUTHORS Fernandez-Nino MA, Arevalo-Ferro C, Dreyer I.
TITLE Direct Submission
JOURNAL Submitted (22-JUL-2014) Biologia, Universidad Nacional de Colombia,
Avenida Carrera 30 # 45, Bogota, Cundinamarca 111321, Colombia
REFERENCE 3 (bases 1 to 7225)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7225)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(22-JUL-2014) Biologia, Universidad Nacional de Colombia, Avenida
Carrera 30 # 45, Bogota, Cundinamarca 111321, Colombia"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7225
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(198..786)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(961..1731)
/codon_start=1
/product="KanR"
/label="KanR"
/note="kanamycin resistance gene"
/protein_id="AKE33862.1"
/translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR
QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHG
QFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTT
FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD
SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF"
CDS 1736..1768
/label="ssrA tag"
/note="C-terminal peptide that mediates degradation in
bacteria through the ClpXP and ClpAP proteases (McGinness
et al., 2006)"
terminator 1786..1872
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind complement(1916..1932)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
regulatory 1936..1991
/label="luxbox"
/note="luxbox"
/regulatory_class="promoter"
CDS 1998..2576
/gene="luxI"
/label="Acyl-homoserine-lactone synthase"
/note="Acyl-homoserine-lactone synthase from Aliivibrio
fischeri. Accession#: P12747"
CDS 2583..2615
/label="ssrA tag"
/note="C-terminal peptide that mediates degradation in
bacteria through the ClpXP and ClpAP proteases (McGinness
et al., 2006)"
terminator 2633..2719
/gene="Escherichia coli rrnB"
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind complement(2763..2779)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
CDS 2782..3609
/gene="aiiB"
/label="N-acyl homoserine lactonase AiiB"
/note="N-acyl homoserine lactonase AiiB from Agrobacterium
fabrum (strain C58 / ATCC 33970). Accession#: A9CKY2"
CDS 3616..3648
/label="ssrA tag"
/note="C-terminal peptide that mediates degradation in
bacteria through the ClpXP and ClpAP proteases (McGinness
et al., 2006)"
terminator 3666..3752
/gene="Escherichia coli rrnB"
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
misc_feature 3733..3815
/note="green fluorescent protein; GFP"
primer_bind complement(3796..3812)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
CDS 3817..3849
/label="ssrA tag"
/note="C-terminal peptide that mediates degradation in
bacteria through the ClpXP and ClpAP proteases (McGinness
et al., 2006)"
terminator 3867..3953
/gene="Escherichia coli rrnB"
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind complement(3997..4013)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
CDS 4020..4727
/label="yeGFP"
/note="yeast-enhanced green fluorescent protein"
terminator 4784..4870
/gene="Escherichia coli rrnB"
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind complement(4914..4930)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 4940..4956
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
protein_bind 4963..4979
/label="lac operator"
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 5021..5032
/note="strong bacterial ribosome binding site (Elowitz and
Leibler, 2000)"
CDS 5039..5788
/gene="luxR"
/label="Transcriptional activator protein LuxR"
/note="Transcriptional activator protein LuxR from
Aliivibrio fischeri. Accession#: P12746"
CDS 5792..5824
/label="ssrA tag"
/note="C-terminal peptide that mediates degradation in
bacteria through the ClpXP and ClpAP proteases (McGinness
et al., 2006)"
terminator 5842..5928
/gene="Escherichia coli rrnB"
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind complement(5972..5988)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
CDS 5994..6572
/gene="luxI"
/label="Acyl-homoserine-lactone synthase"
/note="Acyl-homoserine-lactone synthase from Aliivibrio
fischeri. Accession#: P12747"
CDS 6573..6605
/label="ssrA tag"
/note="C-terminal peptide that mediates degradation in
bacteria through the ClpXP and ClpAP proteases (McGinness
et al., 2006)"
terminator complement(6626..6669)
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
primer_bind complement(6753..6769)
/label="KS primer"
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(6971..7075)
/label="AmpR promoter"
terminator complement(7165..7208)
/label="bacterial terminator"
/note="putative bacterial transcription terminator"
This page is informational only.