pCCB9 vector (V008672)

Download GeneBank File(.gb)

LOCUS       V008672                 7225 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008672
VERSION     V008672
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7225)
  AUTHORS   Fernandez-Nino MA, Arevalo-Ferro C, Dreyer I.
  TITLE     A synthetic multi-cellular network of coupled oscillators
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7225)
  AUTHORS   Fernandez-Nino MA, Arevalo-Ferro C, Dreyer I.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUL-2014) Biologia, Universidad Nacional de Colombia,
            Avenida Carrera 30 # 45, Bogota, Cundinamarca 111321, Colombia
REFERENCE   3  (bases 1 to 7225)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7225)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (22-JUL-2014) Biologia, Universidad Nacional de Colombia, Avenida
            Carrera 30 # 45, Bogota, Cundinamarca 111321, Colombia"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7225
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(198..786)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(961..1731)
                     /codon_start=1
                     /product="KanR"
                     /label="KanR"
                     /note="kanamycin resistance gene"
                     /protein_id="AKE33862.1"
                     /translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR
                     QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHG
                     QFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTT
                     FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD
                     SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF"
     CDS             1736..1768
                     /label="ssrA tag"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      1786..1872
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(1916..1932)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     regulatory      1936..1991
                     /label="luxbox"
                     /note="luxbox"
                     /regulatory_class="promoter"
     CDS             1998..2576
                     /gene="luxI"
                     /label="Acyl-homoserine-lactone synthase"
                     /note="Acyl-homoserine-lactone synthase from Aliivibrio
                     fischeri. Accession#: P12747"
     CDS             2583..2615
                     /label="ssrA tag"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      2633..2719
                     /gene="Escherichia coli rrnB"
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(2763..2779)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             2782..3609
                     /gene="aiiB"
                     /label="N-acyl homoserine lactonase AiiB"
                     /note="N-acyl homoserine lactonase AiiB from Agrobacterium
                     fabrum (strain C58 / ATCC 33970). Accession#: A9CKY2"
     CDS             3616..3648
                     /label="ssrA tag"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      3666..3752
                     /gene="Escherichia coli rrnB"
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     misc_feature    3733..3815
                     /note="green fluorescent protein; GFP"
     primer_bind     complement(3796..3812)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             3817..3849
                     /label="ssrA tag"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      3867..3953
                     /gene="Escherichia coli rrnB"
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(3997..4013)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             4020..4727
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     terminator      4784..4870
                     /gene="Escherichia coli rrnB"
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(4914..4930)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    4940..4956
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     protein_bind    4963..4979
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     RBS             5021..5032
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             5039..5788
                     /gene="luxR"
                     /label="Transcriptional activator protein LuxR"
                     /note="Transcriptional activator protein LuxR from
                     Aliivibrio fischeri. Accession#: P12746"
     CDS             5792..5824
                     /label="ssrA tag"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      5842..5928
                     /gene="Escherichia coli rrnB"
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(5972..5988)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             5994..6572
                     /gene="luxI"
                     /label="Acyl-homoserine-lactone synthase"
                     /note="Acyl-homoserine-lactone synthase from Aliivibrio
                     fischeri. Accession#: P12747"
     CDS             6573..6605
                     /label="ssrA tag"
                     /note="C-terminal peptide that mediates degradation in
                     bacteria through the ClpXP and ClpAP proteases (McGinness
                     et al., 2006)"
     terminator      complement(6626..6669)
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     complement(6753..6769)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        complement(6971..7075)
                     /label="AmpR promoter"
     terminator      complement(7165..7208)
                     /label="bacterial terminator"
                     /note="putative bacterial transcription terminator"