Basic Vector Information
- Vector Name:
- pCBcth14
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5896 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Zheng T, Cui J, Bae HR, Lynd LR, Olson DG.
pCBcth14 vector Vector Map
pCBcth14 vector Sequence
LOCUS V008693 5896 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008693 VERSION V008693 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5896) AUTHORS Zheng T, Cui J, Bae HR, Lynd LR, Olson DG. TITLE Expression of adhA from different organisms in Clostridium thermocellum JOURNAL Biotechnol Biofuels 10, 251 (2017) PUBMED 29213311 REFERENCE 2 (bases 1 to 5896) AUTHORS Zheng T. TITLE Direct Submission JOURNAL Submitted (28-SEP-2017) Biology, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 5896) TITLE Direct Submission REFERENCE 4 (bases 1 to 5896) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels 10, 251 (2017)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-SEP-2017) Biology, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5896 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 1..209 /label="2638" /note="2638" /regulatory_class="promoter" CDS 210..1421 /codon_start=1 /gene="adhA" /product="AdhA" /label="adhA" /note="derived from Caldicellulosiruptor saccharolyticus" /protein_id="AUE21776.1" /translation="MWETKINPFKVFELRCKNTTYFGIGAINKIGDILEDLKKRGINKV ILITGKSSYKISGAWDVVRPALEEKKVDFCIYDKVGPNPTVDMIEEAVEMAKSFGAQAV IGIGGGSPIDTAKSVAVLLEYKDRNARELYEQKFAPEKAVPIIAINLTHGTGTEVDRFA VATIPEKNYKPAIAYDCIYPLYSIDDPQLMTKLDKTQTVAVTVDALNHVTEASTTLVAS PYSILTAQETVRLIAKYLPVAINEPQNLIARYYLLYASALAGISFDNGLLHLTHALEHP LSAVKPELPHGLGLGALLPAIVKTIYPYQAEVLASVYEPIVPNLKGVPSEAEFAAKKVE EWLFEMGCDKKLSDFGFSQSDVDNLVDLALETPSLGLLLSMSPVKATKEVIKKIYEESL YPMK" gene 210..1421 /gene="adhA" /label="adhA" CDS 1551..2198 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(2282..3139) /label="AmpR" /note="beta-lactamase" promoter complement(3140..3231) /label="AmpR promoter" rep_origin 3831..4376 /direction=RIGHT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 4847..5848 /label="repB" /note="RepB replication protein"
This page is informational only.