Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V008700 | pCB301 plasmid pXT1 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pCB301 plasmid pXT1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4623 bp
- Type:
- Plant transformation vector
- Replication origin:
- oriV
- Source/Author:
- Tao X, Yao M, Hu Z, Wei Q, Feng Z.
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pCB301 plasmid pXT1 vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pCB301 plasmid pXT1 vector Sequence
LOCUS 40924_9111 4623 bp DNA circular SYN 17-DEC-2018 DEFINITION Plant transformation vector pCB301 plasmid pXT1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4623) AUTHORS Tao X, Yao M, Hu Z, Wei Q, Feng Z. TITLE Construction of Agrobacterium-mediated Cucumber Mosaic Virus Infectious cDNA Clones and 2b Deletion Viral Vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 4623) AUTHORS Tao X, Yao M, Hu Z, Wei Q, Feng Z. TITLE Direct Submission JOURNAL Submitted (26-MAY-2011) Department of Plant Pathology, Nanjing Agricultural University, No.1 Weigang Street, Nanjing, Jiangsu 210095, P.R.China REFERENCE 3 (bases 1 to 4623) TITLE Direct Submission REFERENCE 4 (bases 1 to 4623) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-MAY-2011) Department of Plant Pathology, Nanjing Agricultural University, No.1 Weigang Street, Nanjing, Jiangsu 210095, P.R.China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4623 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 95..767 /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" misc_feature 768..800 /label=multiple cloning site region /note="multiple cloning site region" ncRNA 800..887 /product="HDV-RZ" /label=ribozyme /note="from hepatitis delta virus" /ncRNA_class="ribozyme" terminator 898..1150 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 1198..1222 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS complement(1377..2522) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" CDS complement(2824..3615) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" rep_origin complement(3827..4458) /direction=LEFT /label=oriV /note="incP origin of replication" misc_feature 4536..4560 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA"