Basic Vector Information
- Vector Name:
- pCASP
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3048 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Widmaier DM, Voigt CA.
pCASP vector Map
pCASP vector Sequence
LOCUS 40924_9056 3048 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCASP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3048) AUTHORS Widmaier DM, Voigt CA. TITLE Secreting Spider Silk in Salmonella JOURNAL Unpublished REFERENCE 2 (bases 1 to 3048) AUTHORS Widmaier DM, Voigt CA. TITLE Direct Submission JOURNAL Submitted (12-DEC-2006) Pharmaceutical Chemistry, UCSF, 1700 4th Street, San Francisco, CA 94158, USA REFERENCE 3 (bases 1 to 3048) TITLE Direct Submission REFERENCE 4 (bases 1 to 3048) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2006) Pharmaceutical Chemistry, UCSF, 1700 4th Street, San Francisco, CA 94158, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3048 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..170 /note="sicA promoter; psicA" /regulatory_class="promoter" CDS 171..563 /codon_start=1 /gene="SicP" /product="SicP" /label=SicP /note="secretion chaperone" /protein_id="ABN48557.1" /translation="MQAHQDIIANIGEKLGLPLTFDDNNQCLLLLDSDIFTSIEAKDDI WLLNGMIIPLSPVCGDSIWRQIMVINGELAANNEGTLAYIDAAETLLLIHAITDLTNTY HIISQLESFVNQQEALKNILQEYAKV" gene 171..563 /gene="SicP" /label=SicP CDS 1054..1074 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" terminator 1146..1232 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" rep_origin complement(1397..1985) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(2073..2167) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(2191..2847) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(2848..2950) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.