Basic Vector Information
- Vector Name:
- pCaPVX760
- Antibiotic Resistance:
- Kanamycin
- Length:
- 13376 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Wang Y, Cong QQ, Lan YF, Geng C, Li XD, Liang YC, Yang ZY, Zhu XP, Li XD.
- Promoter:
- CaMV 35S
pCaPVX760 vector Vector Map
pCaPVX760 vector Sequence
LOCUS V008724 13376 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008724 VERSION V008724 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 13376) AUTHORS Wang Y, Cong QQ, Lan YF, Geng C, Li XD, Liang YC, Yang ZY, Zhu XP, Li XD. TITLE Development of new potato virus X-based vectors for gene over-expression and gene silencing assay JOURNAL Virus Res. 191, 62-69 (2014) PUBMED 25076104 REFERENCE 2 (bases 1 to 13376) AUTHORS Wang Y, Cong QQ, Li XD. TITLE Direct Submission JOURNAL Submitted (10-APR-2014) Department of Plant Pathology, Shandong Agricultural University, No. 61 Daizong street, Tai'an, Shandong Province 271018, PR China REFERENCE 3 (bases 1 to 13376) TITLE Direct Submission REFERENCE 4 (bases 1 to 13376) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Virus Res. 191, 62-69 (2014)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-APR-2014) Department of Plant Pathology, Shandong Agricultural University, No. 61 Daizong street, Tai'an, Shandong Province 271018, PR China" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..13376 /mol_type="other DNA" /organism="synthetic DNA construct" 5'UTR 1..84 /label="derived from PVX isolate 1985" /note="derived from PVX isolate 1985" CDS 85..4452 /note="RNA replication protein from Potato virus X. Accession#: P09395" /label="RNA replication protein" CDS 4486..5163 /note="Movement and silencing protein TGBp1 from Potato virus X (strain X3). Accession#: P17780" /label="Movement and silencing protein TGBp1" CDS 5147..5494 /codon_start=1 /gene="TGB2" /product="triple gene block protein 2" /label="TGB2" /protein_id="AII77193.1" /translation="MSAQGHRLTAPVNSEKVYIVLGLSFALVSITFLLSRSNLPHVGDN IHSLPHGGAYRDGTKAILYNSPNLGSRVSLHNGKNAAFAAVLLLTLLIYGSKYISQRNH TCACGNNHSSH" gene 5147..5494 /gene="TGB2" /label="TGB2" /note="derived from PVX isolate 1985" CDS 5427..5639 /codon_start=1 /gene="TGB3" /product="triple gene block protein 3" /label="TGB3" /protein_id="AII77194.1" /translation="MEVNTYLNAIILVLVVTIIAVISTSLVRTEPCVIKITGESITVLA CKLDAETIRAIADLKPLSVERLSFH" gene 5427..5639 /gene="TGB3" /label="TGB3" /note="derived from PVX isolate 1985" RBS 5496..5504 /label="Shine-Dalgarno sequence" /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" misc_feature 5668..5691 /label="cloning site" /note="cloning site" misc_feature 5692..5902 /note="derived from tobacco mosaic virus coat protein subgenomic promoter" misc_feature 5903..5932 /label="multiple cloning site" /note="multiple cloning site" regulatory 5933..6014 /label="derived from PVX isolate 1985" /note="derived from PVX isolate 1985" /regulatory_class="promoter" misc_feature 6009..6032 /label="multiple cloning site" /note="multiple cloning site" 3'UTR 6033..6133 /label="derived from PVX isolate 1985" /note="derived from PVX isolate 1985" CDS 6190..6207 /label="6xHis" /note="6xHis affinity tag" terminator 6242..6494 /label="NOS terminator" /note="nopaline synthase terminator and poly(A) signal" misc_feature 6516..6540 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" CDS 7840..8466 /label="pVS1 StaA" /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 8903..9967 /label="pVS1 RepA" /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 10036..10230 /label="pVS1 oriV" /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 10574..10714 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(10900..11488) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(11578..12369) /label="KanR" /note="aminoglycoside phosphotransferase" misc_feature 12794..12818 /label="LB T-DNA repeat" /note="left border repeat from nopaline C58 T-DNA" promoter 13033..13376 /label="CaMV 35S promoter" /note="strong constitutive promoter from cauliflower mosaic virus"
This page is informational only.