Basic Vector Information
- Vector Name:
- pCAMFhGNTIf1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6213 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pCAMFhGNTIf1 vector Map
pCAMFhGNTIf1 vector Sequence
LOCUS 40924_8951 6213 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAMFhGNTIf1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6213) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6213) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6213) TITLE Direct Submission REFERENCE 4 (bases 1 to 6213) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6213 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal 149..204 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(565..581) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(589..605) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(613..643) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(657..678) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 736..932 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 938..1072 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1310..1898) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2072..2929) /label=AmpR /note="beta-lactamase" promoter complement(2930..3034) /label=AmpR promoter enhancer 3065..3444 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 3446..3723 /label=chicken beta-actin promoter misc_feature 3817..4696 /label=intron /note="intron" CDS 4707..4961 /label=alpha-factor secretion signal /note="N-terminal secretion signal from S. cerevisiae alpha-factor" CDS 4962..6176 /codon_start=1 /note="unnamed protein product; hGNTI" /protein_id="SJL88472.1" /translation="ALDGDPASLTREVIRLAQDAEVELERQRGLLQQIGDALSSQRGRV PTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGH EETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPA AVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDF FPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHG QFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKEL GEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGY DPSWN"
This page is informational only.