Basic Vector Information
- Vector Name:
- pCAM-RTBV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10868 bp
- Type:
- Plant transformation vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Dutt M, Ananthakrishnan G, Jaromin MK, Brlansky RH, Grosser JW.
- Promoter:
- NOS
pCAM-RTBV vector Map
pCAM-RTBV vector Sequence
LOCUS 40924_8666 10868 bp DNA circular SYN 17-DEC-2018 DEFINITION Plant transformation vector pCAM-RTBV, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10868) AUTHORS Dutt M, Ananthakrishnan G, Jaromin MK, Brlansky RH, Grosser JW. TITLE Evaluation of four phloem-specific promoters in vegetative tissues of transgenic citrus plants JOURNAL Tree Physiol. 32 (1), 83-93 (2012) PUBMED 22228816 REFERENCE 2 (bases 1 to 10868) AUTHORS Dutt M, Ananthakrishnan G, Jaromin M, Brlansky R, Grosser J. TITLE Direct Submission JOURNAL Submitted (01-MAR-2012) Citrus Research and Education Center, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA REFERENCE 3 (bases 1 to 10868) TITLE Direct Submission REFERENCE 4 (bases 1 to 10868) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Tree Physiol."; date: "2012"; volume: "32"; issue: "1"; pages: "83-93" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-MAR-2012) Citrus Research and Education Center, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10868 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 34..788 /label=RTBV promoter /note="RTBV promoter" /regulatory_class="promoter" CDS 799..2607 /codon_start=1 /gene="gus" /product="GUS" /label=gus /note="beta-glucuronidase" /protein_id="AFM76970.1" /translation="MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGQQF LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD KNHPSVVMWSIANEPDTRPQVHGNISPLAEATRKLDPTRPITCVNVMFCDAHTDTISDL FDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYT DMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKP KSAAFLLQKRWTGMNFGEKPQQGGKQ" gene 799..2607 /gene="gus" /label=gus /note="uidA" regulatory 2622..2912 /label=35S - 3' /note="35S - 3'" /regulatory_class="terminator" polyA_signal 2666..2840 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" promoter 3042..3225 /label=NOS promoter /note="nopaline synthase promoter" CDS 3243..4031 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 4091..4265 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" misc_feature complement(4343..4367) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 4792..5583 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 5673..6261 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(6447..6587) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(6931..7125) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7194..8258) /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(8695..9321) /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature complement(10621..10645) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 10848..10864 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.